Skip to main content

Conference of the Birds invisible dance of CRISPR-Cas9 Closing in on a cure for Duchenne muscular dystrophy

Transcendental realism

Initially developed by Roy Bhaskar in his book A Realist Theory of Science (1975), transcendental realism is a philosophy of science that was initially developed as an argument against epistemic realism of positivism and hermeneutics. The position is based on Bhaskar's transcendental arguments for certain ontological and epistemological positions based on what reality must be like in order for scientific knowledge to be possible.

The overview of transcendental realism that follows is largely based on Andrew Sayer's Realism and Social Science.

consider applications in

Horseshoe theory

and with the American Indian College Fund is a nonprofit organization that helps Native American students, providing them with support through scholarships and funding toward higher education.

Critical realism (philosophy of the social sciences)

Critical realism is a philosophical approach to understanding science initially developed by Roy Bhaskar (1944–2014). It combines a general philosophy of science (transcendental realism) with a philosophy of social science (critical naturalism). It specifically opposes forms of empiricism and positivism by viewing science as concerned with identifying causal mechanisms. In the last decades of the twentieth century it also stood against various forms of postmodernism and poststructuralism by insisting on the reality of objective existence. In contrast to positivism's methodological foundation, and poststructuralism's epistemological foundation, critical realism insists that (social) science should be built from an explicit ontology. Critical realism is one of a range of types of philosophical realism, as well as forms of realism advocated within social science such as analytic realism[1] and subtle realism.[2][3]

Flying Saucer Daffy

Larry and Moe ask Joe to get them a Lawyer... a cheap lawyer
How about housing the orphans and widows like it says in the book of James Pope Francis?

The Seven Valleys

The Seven Valleys (Persian: هفت وادیHaft-Vádí) is a book written in Persian by Baháʼu'lláh, the founder of the Baháʼí Faith. The Seven Valleys follows the structure of the Persian poem The Conference of the Birds.

The Seven Valleys is usually published together with The Four Valleys (Persian: چهار وادیChahár Vádí), which was also written by Baháʼu'lláh, under the title The Seven Valleys and the Four Valleys. The two books are distinctly different and have no direct relation.[citation needed] In February 2019 an authorized translation of both titles and some others was published by the Baháʼí World Centre in the collection The Call of the Divine Beloved.[1]

The Australian Bassian thrush farts toward the ground, with the noxious smell helping to unearth worms and other insect prey. Bassian thrush are known to dislodge their prey out of pile of leaves by disturbing the leaf litter. The birds move quietly, but often pause, to listen for the movements of the insects. They also disturb worm prey by farting, which provokes the worms to move.  The Bassian thrush releases gas to scare worms out of hiding.

meet
little bird told me. Fig. a way of indicating that you do not want to reveal who told you something. (Sometimes used playfully, when you think that the person you are addressing knows or can guess who was the source of your information.)
What do the feathers in a headdress represent?

The headdress is a well-known symbol of strength and bravery in Native American culture. It is believed that the Sioux were of the first tribes to wear the feather headdress. ... Historically, headdresses have been worn by the most powerful and influential members among a tribe and were not typically made in one day.

Who wears a feathered headdress and why?

War bonnets (also called warbonnets or headdresses) are feathered headgear traditionally worn by male leaders of the American Plains Indians Nations who have earned a place of great respect in their tribe. Originally they were sometimes worn into battle, but they are now primarily used for ceremonial occasions.
 
 
 
 
 
 

 
 

 

 
 
 

Rio Grande Valley

The mountains are high as the valleys are low.

Jacob's Ladder

Jacob wrestling with the angel

Jacobian matrix and determinant

Hamilton–Jacobi–Bellman equation

HUNGVINHTRAN

Applications in atomic and molecular physics

See also

N is a Number: A Portrait of Paul Erdős

Filter (mathematics) 

Bahíyyih Khánum (1846 – July 15, 1932) was the only daughter of Baháʼu'lláh, the founder of the Baháʼí Faith, and Ásíyih Khánum.[1] She was born in 1846 with the given name Fatimih Sultan,[2][3] and was entitled "Varaqiy-i-'Ulyá" or "Greatest Holy Leaf".

He is the Eternal! This is My testimony for her who hath heard My voice and drawn nigh unto Me. Verily, she is a leaf that hath sprung from this preexistent Root. She hath revealed herself in My name and tasted of the sweet savours of My holy, My wondrous pleasure. At one time We gave her to drink from My honeyed Mouth, at another caused her to partake of My mighty, My luminous Kawthar. Upon her rest the glory of My name and the fragrance of My shining robe.

BAHÍYYIH KHÁNUM

A compilation
from Bahá'í sacred texts and writings of the Guardian
of the Faith and Bahíyyih Khánum's own letters
made by

THE RESEARCH DEPARTMENT
at the Bahá'í World Centre

Samovar

Tasseography

Tasseography (also known as tasseomancy, tassology, or tasseology) is a divination or fortune-telling method that interprets patterns in tea leaves, coffee grounds, or wine sediments.

The terms derive from the French word tasse (cup), which in turn derives from the Arabic loan-word into French tassa, and the Greek suffixes -graph (writing), -logy (study of), and -mancy (divination).

Parousia

Prophecy (Shia Islam)

Great Schism 

A random seed (or seed state, or just seed) is a number (or vector) used to initialize a pseudorandom number generator.

For a seed to be used in a pseudorandom number generator, it does not need to be random. Because of the nature of number generating algorithms, so long as the original seed is ignored, the rest of the values that the algorithm generates will follow probability distribution in a pseudorandom manner.

A pseudorandom number generator's number sequence is completely determined by the seed: thus, if a pseudorandom number generator is reinitialized with the same seed, it will produce the same sequence of numbers.

The choice of a good random seed is crucial in the field of computer security. When a secret encryption key is pseudorandomly generated, having the seed will allow one to obtain the key. High entropy is important for selecting good random seed data.[1]

If the same random seed is deliberately shared, it becomes a secret key, so two or more systems using matching pseudorandom number algorithms and matching seeds can generate matching sequences of non-repeating numbers which can be used to synchronize remote systems, such as GPS satellites and receivers.

Random seeds are often generated from the state of the computer system (such as the time), a cryptographically secure pseudorandom number generator or from a hardware random number generator.

Watering the Seeds of Love

Growing Mindful Relationships By Jerry Braza 

Thích Nhất Hạnh 

I am on a mission to cure muscular dystrophy and have proposed girls v. boys with a conference of the Birds invisible dance of of CRISPR-Cas9. Thank you Maggie for help with direction from the Greatest Holy Leaf,

Abstract: Infallibility is a complex term in Bahá'í scripture that has not been much discussed in Bahá'í secondary literature. The concept, which has analogies in Catholicism and Islam, is historically burdened and has become obsolete in secular thought. This paper analyses two categories of "infallibility": essential infallibility which is inherent in the messengers of God, and conferred infallibility which is a characteristic of the institutions of the Guardianship and the Universal House of Justice. This paper focuses on the Universal House of Justice. Does its infallibility operate to an unlimited extent? Are every one of its decisions infallible, and if not, what are its boundaries? The immanent limits of this charisma are analysed and a detailed argument provided that supports a defensible restrictive interpretation 

Shunning

What is the purpose of shunning?
 
Shunning, social control mechanism used most commonly in small tight-knit social groups to punish those who violate the most serious group rules. It is related to exile and banishment, although shunning is based on social rather than physical isolation or separation.

Silent treatment

Narcissistic parent


Enmeshment

cabrón is a Spanish slang word, literally meaning "male goat," andd roughly equivalent to the English bastard, badass, dumb ass or dude, depending on context.... sort of like a family or community scapegoat. We may also consider:

A sacrificial lamb is a metaphorical reference to a person or animal sacrificed for the common good. The term is derived from the traditions of Abrahamic religion where a lamb is a highly valued possession.  The black sheep in the family is also associated with shunning and as a scapegoat  

Binding of Isaac (Hebrew: עֲקֵידַת יִצְחַקʿAqēḏaṯ Yīṣḥaq, in Hebrew also simply "the Binding", הָעֲקֵידָהhāʿAqēḏāh)

Yoga is typically defined as “to yoke” as in to join two things together. In the western understanding of this it generally means joining mind and spirit or body, mind and spirit.

Saturn Devouring His Son

Transitive relation

Parent function

Parent Functions And Their Graphs

A nuclear family, elementary family or conjugal family is a family group consisting of parents and their children. It is in contrast to a single-parent family, the larger extended family, or a family with more than two parents.

Nucleon is the collective term for protons and neutrons. Nucleons are the particles found in the nucleus of atoms. ... Through a beta decay, the weak force can turn one nucleon into another nucleon—either protons to neutrons or neutrons to protons. Nucleons are incredibly small, about 10-15 m, 10,000x smaller than an atom!
What are nucleons made of?
In physics and chemistry, a nucleon refers to any subatomic particle found in the nucleus of an atom. For instance, protons and neutrons are nucleons, since they are in the nucleus of the atom. Nucleons are made of quarks.
HCC and MFA in Houston noted how the 'new world' was depicted as a 'garden of eden' from the Bible with artists as Church.
PROSITE is a protein database.[1][2] It consists of entries describing the protein families, domains and functional sites as well as amino acid patterns and profiles in them. These are manually curated by a team of the Swiss Institute of Bioinformatics and tightly integrated into Swiss-Prot protein annotation. PROSITE was created in 1988 by Amos Bairoch, who directed the group for more than 20 years. Since July 2018, the director of PROSITE and Swiss-Prot is Alan Bridge.

 

https://prosite.expasy.org/


The nitrogenous bases in DNA are adenine (A), guanine (G), thymine (T), and cytosine (C). The nitrogenous bases in RNA are the same, with one exception: adenine (A), guanine (G), uracil (U), and cytosine (C)

Finding nuclear localization signals

Codon usage bias

 I'm OK – You're OK is a 1967 self-help book by Thomas Anthony Harris.

John Bradshaw (author)

Inner Child,’

John Bradshaw's son

Brad Isaacs

TV producer

Compare and contrast with Evangelical 

Rick Warren

Thank God for reality... and the means to escape from it!

It's All in Your Head (Negativland album)

Religious war

According to the Encyclopedia of Wars, out of all 1,763 known/recorded historical conflicts, 123, or 6.98%, had religion as their primary cause. Matthew White's The Great Big Book of Horrible Things gives religion as the primary cause of 11 of the world's 100 deadliest atrocities.

War and religion

Some arguments a son may engage in with a father are perhaps best suited for opera and other humanitarian art. Indeed, some topics can be maddening if debated and argued. Even if they cry to an uncle over an argument one has had with one's father in lieu of an expensive psychotherapist, priest, guru or shaman.
 

Panpsychism

Philosophy of mind

Artificial consciousness

Pejorative

Loaded language

Coffee, tea, snacks?
The percolation threshold is a mathematical concept in percolation theory that describes the formation of long-range connectivity in random systems. Below the threshold a giant connected component does not exist; while above it, there exists a giant component of the order of system size. In engineering and coffee making, percolation represents the flow of fluids through porous media, but in the mathematics and physics worlds it generally refers to simplified lattice models of random systems or networks (graphs), and the nature of the connectivity in them. The percolation threshold is the critical value of the occupation probability p, or more generally a critical surface for a group of parameters p1, p2, ..., such that infinite connectivity (percolation) first occurs. 

Small Business Education and Entrepreneurial Development (SEED)


SBIR

NIH Innovator Support

Experienced life science executives to help take your technology to the market

Trial Innovation Network 

Quantum Machine Learning: a faster clustering algorithm on a quantum computer

Tensorflow

Quantum spectral clustering

Iordanis Kerenidis and Jonas Landman
Phys. Rev. A 103, 042415 – Published 15 April 2021

Algebraic structure

Parallel Virtual Machine

Node (computer science)

Jeremiah was a performance artist...

The Conference of the Birds

The title is taken directly from the Qur’an, 27:16, where Sulayman (Solomon) and Dāwūd (David) are said to have been taught the language, or speech, of the birds (manṭiq al-ṭayr)... The hoopoe tells the birds that they have to cross seven valleys in order to reach the abode of Simorgh. These valleys are as follows:[3]

1. Valley of the Quest, where the Wayfarer begins by casting aside all dogma, belief, and unbelief.
2. Valley of Love, where reason is abandoned for the sake of love.
3. Valley of Knowledge, where worldly knowledge becomes utterly useless.
4. Valley of Detachment, where all desires and attachments to the world are given up. Here, what is assumed to be “reality” vanishes.
5. Valley of Unity, where the Wayfarer realizes that everything is connected and that the Beloved is beyond everything, including harmony, multiplicity, and eternity.
6. Valley of Wonderment, where, entranced by the beauty of the Beloved, the Wayfarer becomes perplexed and, steeped in awe, finds that he or she has never known or understood anything.
7. Valley of Poverty and Annihilation, where the self disappears into the universe and the Wayfarer becomes timeless, existing in both the past and the future.

Introducing Texans to Common Birds

Raphael (/ˈræfiəl/; Hebrew: רְפָאֵל‎, translit. Rəp̄āʾēl, lit. 'God has healed'; Ancient Greek: Ραφαήλ, Raphaḗl; Coptic: ⲣⲁⲫⲁⲏⲗ, Rafaêl; Arabic: رافائيل‎, Rafā’īl, or إسرافيل, Isrāfīl; Amharic: ሩፋኤል, Rufaʾel) is an archangel mentioned in the Book of Tobit and in 1 Enoch, both dating from the last few centuries before Christ.[2][3] In later Jewish tradition he became identified as one of the three heavenly visitors entertained by Abraham. He is not named in either the Christian New Testament or the Quran, but in later Christian tradition he became identified with healing and as the angel who stirred the waters of the pool of Bethesda in John 5:2-4,[2] while in Islam, where his name is Israfil, he is understood to be the unnamed angel of Quran 6:73 who stands eternally with a trumpet to his lips, ready to announce the Day of Resurrection.

Gabriel's Horn

The term "spirit" in reference to alcohol stems from Middle Eastern alchemy. These alchemists were more concerned with medical elixirs than with transmuting lead into gold. The vapor given off and collected during an alchemical process (as with distillation of alcohol) was called a spirit of the original material.

a little bird told me

troubles with Twitter

Garuda

Garuda (Sanskrit: गरुड Garuḍa; Pāli: गरुळ Garuḷa), also Galon or Nan Belu in Burmese and Karura in Japanese, is a legendary bird or bird-like creature in Hindu, Buddhist and Jain faith.[1][3][4] He is variously the vehicle mount (vahana) of the Hindu god Vishnu, a dharma-protector and Astasena in Buddhism, and the Yaksha of the Jain Tirthankara Shantinatha.[3][4][5] The Brahminy kite is considered as the contemporary representation of Garuda.

Harvey Birdman, Attorney at Law

Where did the myth of the genie come from?

Genies or jinns or djinns are supposed to be magical beings or creatures with free will. They are originally found in ancient myths and legends of the Middle East, especially Arabia.
Which mosque was built by jinns?
The Mosque of the Jinn (Arabic: مسجد الجنّ‎, romanized: Masjid al-Jinn) is a mosque in Mecca, Saudi Arabia, located near Jannat al-Mu'alla.
Who is the father of jinn?
Abu Al-Jann
The father of the jinn is also called Abu Al-Jann.
To bottle up your emotions means suppressing your innermost feelings. It is when you avoid venting out what you really feel. There is the fear that you may appear weak, or you just prefer keeping your emotions to yourself, which is common. It's like sweeping the dirt under the rug and keep the lid of a boiling pot.

What are jinns in Quran?
The Translation of Surah Al-Jinn (The Demon Race)

Similar to angels, the Jinn Race or Demon Race are spiritual beings invisible to the naked human eye. In the Quran, it is stated that humans are created from the earth and jinn (demon) from smokeless fire in more than one instance.
What are the signs of jinn?

There have been a few studies documenting the relationships between jinn possession and mental illness among contemporary Muslims. El-Islam 26 reported that symptoms such as morbid fears, forgetfulness and lack of energy are commonly attributed to jinn in the Arab world.
 
Which Para is Surah Jinn?
72nd chapter
Al-Jinn (Arabic: الجن‎, “The Jinn”) is the 72nd chapter (sūrah) of the Quran with 28 verses (āyāt). The name as well as the topic of this chapter is jinn. Similar to angels, the jinn are beings invisible to the naked human eye.

Al-Jinn

Sabr

Sabr (Arabic: صَبْرٌ‎, romanized: ṣabr) (literally 'endurance' or more accurately 'perseverance' and 'persistence') is one of the two parts of faith (the other being shukr) in Islam. It teaches to remain spiritually steadfast and to keep doing good actions in the personal and collective domain, specifically when facing opposition or encountering problems, setbacks, or unexpected and unwanted results. It is patience in face of all unexpected and unwanted outcomes.

Also consider:

Seraphiel (Hebrew שׂרפיאל, meaning "Prince of the High Angelic Order") is the name of an angel in the apocryphal Book of Enoch.

Protector of Metatron, Seraphiel holds the highest rank of the Seraphim with the following directly below him, Jehoel. In some texts,[which?] he is referred to as the Angel of Silence. Eponymously named as chief of the Seraphim, one of several for whom this office is claimed, Seraphiel is one of eight judge angels and a prince of the Merkabah.[1] In 3 Enoch, Seraphiel is described as an enormous, brilliant angel as tall as the seven heavens with a face like the face of angels and a body like the body of eagles. He is beautiful like lightning and the light of the morning star. As chief of the seraphim, he is committed to their care and teaches them songs to sing for the glorification of God. In magical lore, Seraphiel is one of the rulers of Tuesday and also the planet Mercury. He is invoked from the North.[1][2]

Israfil could likely be his counterpart in Islam, one of the Archangels and an angel of music with a similar name of the same meaning.  

A demagogue /ˈdɛməɡɒɡ/ (from Greek δημαγωγός, a popular leader, a leader of a mob, from δῆμος, people, populace, the commons + ἀγωγός leading, leader)[1] or rabble-rouser[2][3] is a political leader in a democracy who gains popularity by arousing the common people against elites, especially through oratory that whips up the passions of crowds, appealing to emotion by scapegoating out-groups, exaggerating dangers to stoke fears, lying for emotional effect, or other rhetoric that tends to drown out reasoned deliberation and encourage fanatical popularity.[4] Demagogues overturn established norms of political conduct, or promise or threaten to do so.[5]

The Ant People of the Hopi

Adam Ant not included

Bakhshali manuscript


University of California, Riverside

The Mystery of Chaco Canyon

Since the discovery of the prehistoric ruins of Chaco Canyon, New Mexico, their purpose has baffled archaeologists. The Mystery of Chaco Canyon challenges the long-held assumption that Chaco was a center of trade and offers an explanation of the site which reveals the brilliant astronomy of ancient pueblo people.

The one hour documentary, narrated by Robert Redford, premiered nationally on PBS on June 16, 2000.

Not so fast...

Did China discover AMERICA? Ancient Chinese script carved into rocks may prove Asians lived in New World 3,300 years ago

  • Author and researcher John Ruskamp claims to have found pictograms from the ancient Chinese Shang Dynasty etched into rocks in America
  • The symbols are carved into rocks in New Mexico, California and Arizona
  • He says the Chinese were exploring North America long before Europeans
  • He claims the symbols give details of journeys and honour the Shang king
King Wu of Zhou and who knows who from Timbuktu?

Petroglyphs, Pictographs, and a Geoglyph: Rock Art of the American Southwest

Ancient DNA confirms Native Americans’ deep roots in North and South America

By Lizzie Wade

Genetic link between Asians and native Americans: evidence from HLA genes and haplotypes

K Tokunaga  1 J OhashiM BannaiT Juji

Antiochus IV Epiphanes

Antiochus Epiphanes—The Bible’s Most Notoriously Forgotten Villain

Hanukah is the story of the Jewish revolt against Antiochus

A cult of personality, or cult of the leader,[1] arises when a country's regime – or, more rarely[citation needed], an individual – uses the techniques of mass media, propaganda, the big lie, spectacle, the arts, patriotism, and government-organized demonstrations and rallies to create an idealized, heroic, image of a leader, often through unquestioning flattery and praise. A cult of personality is similar to apotheosis, except that it is established by modern social engineering techniques, usually by the state or the party in one-party states and dominant-party states. It is often seen in totalitarian or authoritarian countries.

Gene Therapy for Cancer Treatment: Past, Present and Future

Hero's journey

Seven Factors of Awakening

In Buddhism, the Seven Factors of Awakening (Pali: satta bojjha or satta sambojjha; Skt.: sapta bodhyanga) are:

  • Mindfulness (sati, Sanskrit smrti). To maintain awareness of reality (dharma).
  • Investigation of the nature of reality (dhamma vicaya, Skt. dharmapravicaya).
  • Energy (viriya, Skt. vīrya) also determination, effort
  • Joy or rapture (pīti, Skt. prīti)
  • Relaxation or tranquility (passaddhi, Skt. prashrabdhi) of both body and mind
  • Concentration, (samādhi) a calm, one-pointed state of mind, or clear awareness
  • Equanimity (upekkha, Skt. upekshā). To accept reality as-it-is (yathā-bhuta) without craving or aversion.

This evaluation of seven awakening factors is one of the "Seven Sets" of "Awakening-related states" (bodhipakkhiyadhamma).

The Pali word bojjhanga is a compound of bodhi ("awakening," "enlightenment") and anga ("factor").

Kleshas (Hinduism)

Kleśa (sanskrit क्लेश, also klesha ) is a term from Indian philosophy and yoga, meaning a "poison". The third śloka of the second chapter of Patañjali's Yoga sūtras explicitly identifies Five Poisons (Sanskrit: pañcakleśā):

अविद्यास्मितारागद्वेषाभिनिवेशाः पञ्च क्लेशाः॥३॥
Avidyāsmitārāgadveṣābhiniveśāḥ pañca kleśāḥ[1]

Translated into English, these five (pañca) Kleśa-s or Afflictions (kleśāḥ) are:[1]

  • Ignorance (in the form of a misapprehension about reality) (ávidyā),
  • egoism (in the form of an erroneous identification of the Self with the intellect) (asmitā, ego; vanity, pride; assertion),
  • attachment (rāga, coloring, tingeing, dyein: melodic mode, attachment to a sensory object: greed, sensuality, lust, desire),
  • aversion (dveṣa, Dveṣa literally mean ‘that which causes repulsion, hatred or dislike), and
  • fear of death (which is derived from clinging ignorantly to life) (abhiniveśāḥ).

The 24th sutra of the first chapter, Samadhi Pada, Patanjali describes a purusha free of kleshas

शकभयणवऩाकाशमैयऩयाभृष्ट् ऩ रुषणवश ष ईश्वय् ॥ २४॥
kleshakarmavipakashayairaparamrishtah purushavishesh eeshvarah[1]
Isvara (God/the Supreme Ruler) is a special Purusa (Spirit), untouched by kleshas, or by karmas - the results of actions or desires.

Jali

Pancha Bhoota

The Five Elements

TAT TVAM ASI 

Griot

A griot (/ˈɡr/; French: [ɡʁi.o]; Manding: jali or jeli (djeli or djéli in French spelling); Serer: kevel or kewel; Wolof: gewel) is a West African historian, storyteller, praise singer, poet, or musician. The griot is a repository of oral tradition and is often seen as a leader due to their position as an advisor to royal personages. As a result of the former of these two functions, they are sometimes called a bard.
 
Conscience is a cognitive process that elicits emotion and rational associations based on an individual's moral philosophy or value system.
 
Psychological projection is a defense mechanism in which the ego defends itself against unconscious impulses or qualities by denying their existence in themselves and attributing them to others.
A raga or raag is a melodic framework for improvisation akin to a melodic mode in Indian classical music.
 

Kleshas (Buddhism)

Jeremiah

According to its opening verses the book records the prophetic utterances of the priest Jeremiah son of Hilkiah, "to whom the word of YHWH came in the days of king Josiah" and after. Jeremiah lived during a turbulent period, the final years of the kingdom of Judah, from the death of king Josiah (609 BCE) and the loss of independence that followed, through the destruction of Jerusalem by the Babylonians and the exile of much its population (587/586).[19] The book depicts a remarkably introspective prophet, impetuous and often angered by the role into which he has been thrust, alternating efforts to warn the people with pleas to God for mercy, until he is ordered to "pray no more for this people." He engages in extensive performance art, walking about in the streets with a yoke about his neck and engaging in other efforts to attract attention. He is taunted and retaliates, is thrown in jail as the result, and at one point is thrown into a pit to die.

Gut bacteria may 'talk' to the brain, mouse study suggests



What's with mice and rat as models?

Pythons eat mice and rats so what the philosophical insight for disease modeling software innovations with nanowire hardware nanomedicine innovations?
 
I have petitioned the Church and petitioned the state. Please stop torturing mice.

Perhaps they may respect performance art with song and dance acts, especially if an Ashram and Synagogue support such arts as patrons if not the church. Also Debbie Kiesar at Imagine Art...

The telethon was held annually on Labor Day weekend beginning in 1966, and raised $2.45 billion for MDA from its inception through 2009.
...
The Jerry Lewis MDA Labor Day Telethon.
MDA Labor Day Telethon
Running time1,290 minutes (1966–2010) 360 minutes (2011) 180 minutes (2012) 120 minutes (2013–2014)

University of Texas

Cellular and Biomolecular Engineering

My name is David Vincent Bell Hirsch and I have been researching a cure for the type of muscular dystrophy my friend Carole Zoom has. 

Fiber (mathematics)

In mathematics, the term fiber (US English) or fibre (British English) can have two meanings, depending on the context:

  1. In naive set theory, the fiber of the element y in the set Y under a map f : XY is the inverse image of the singleton {y} under f.
  2. In algebraic geometry, the notion of a fiber of a morphism of schemes must be defined more carefully because, in general, not every point is closed.

In computer science, a fiber is a particularly lightweight thread of execution.

Like threads, fibers share address space. However, fibers use cooperative multitasking while threads use preemptive multitasking. Threads often depend on the kernel's thread scheduler to preempt a busy thread and resume another thread; fibers yield themselves to run another fiber while executing. 

Beowulf, a hero of the Geats, comes to the aid of Hrothgar, the king of the Danes, whose mead hall in Heorot has been under attack by the monster Grendel.

Once there were skateboarders who got a cable television show. And on that show, they allowed themselves to be bitten by snakes, attacked by dogs, and subjected to all manner of olfactory terrors. And then they were gone. How did ‘Jackass’ succeed where so many other jackasses have failed?

Snake handling in religion

The snakes in the lake are probably there to enhance the atmosphere of evil in the region. A third reason why the home of the monsters may be likened to hell has to do with who Grendel is. Hell, in Christianity, is a place where people who have sinned must go to suffer.

Name: Witiko
Tribal affiliation: Cree, Atikamekw
Alternate spellings: Wihtikiw, Wihtikow, Wihtiko, Wiihtiko, Wetiko, Uitiko, Wiitiko, Weetigo, Witiku, Witigo, Weetekow, Weeteego, Wee-tee-go, Outikou, Outiko, Weediko, Wi'tiko, Weeghteko, Wehtigo, Wetigo, Wihtigo, Weh-ta-ko, Whit-Te-Co. Witikowak is a plural form (also spelled wihtikowak or wihtikiwak.)
Pronunciation: Varies by dialect: usually wih-tih-kew or wih-tih-koh.
Type: Monster, ice cannibal
Related figures in other tribes: Windigo (Anishinabe), Kee-wakw (Abenaki), Chenoo (Mi'kmaq)

Consider the monster Grendel... Joseph Campbell's Hero's Journey and

Witiko are evil man-eating giants of Cree mythology. Witikos play the roles of monsters and bogeymen in some legends; in others, Cree people who commit sins (especially selfishness, gluttony, or cannibalism) are turned into a Witiko as punishment. The appearance of a Witiko is huge, monstrous, and made of or coated in ice. In some Cree stories, looking directly at a Witiko will leave a person paralyzed and helpless against it. Witiko's heart is said to be made of ice, and the monster can only be permanently killed if its heart is completely melted. 

Poltergeist (computer programming)

The American Indian College Fund is a nonprofit organization that helps Native American students, providing them with support through scholarships and funding toward higher education. The fund provides an average of 6,000 annual scholarships for American Indian students and also provides support for other needs at the tribal colleges ranging from capital support to cultural preservation activities. Charity Navigator gave the College Fund an overall rating of 88.36 out of 100.[1]
 
Serenity Sells Quantum neural network SMBR/SBIR solutions

CRISPR

CRISPR (/ˈkrɪspər/) (which is an acronym for clustered regularly interspaced short palindromic repeats)

Computer cluster

Quantum clustering

The Python Programing Meetup group may utilize SLACK

NIH Intramural Data Science Slack group. https://join.slack.com/t/nihdatascience/signup

BioWoulf

Classes, Seminars & Walk-In Consults

Beowulf cluster


The NIH HPC group plans, manages and supports high-performance computing systems specifically for the intramural NIH community. These systems include Biowulf, a 105,000+ processor Linux cluster; Helix, an interactive system for file transfer and management, Sciware, a set of applications for desktops, and Helixweb, which provides a number of web-based scientific tools. We provide access to a wide range of computational applications for genomics, molecular and structural biology, mathematical and graphical analysis, image analysis, and other scientific fields. 

Debye

An adparticle is an atom, molecule, or cluster of atoms or molecules that lies on a crystal surface. The term is used in surface chemistry. The word is a contraction of "adsorbed particle". An adparticle that is a single atom may be referred to as an "adatom".

Jacquard machine

Sky Loom

Native American Myth, Story, and Song

Edited and with an introduction by Brian Swann

Cloud computing



 Strings are applied e.g. in Bioinformatics to describe DNA strands composed of nitrogenous bases.

Bioinformatics

Telomere

A telomere (/ˈtɛləmɪər/ or /ˈtləmɪər/, from Ancient Greek: τέλος, romanizedtélos, lit.'end' and Ancient Greek: μέρος, romanizedméros, lit.'part') is a region of repetitive nucleotide sequences associated with specialized proteins at the ends of linear chromosomes. Although there are different architectures, telomeres, in a broad sense, are a widespread genetic feature most commonly found in eukaryotes. In most, if not all species possessing them, they protect the terminal regions of chromosomal DNA from progressive degradation and ensure the integrity of linear chromosomes by preventing DNA repair systems from mistaking the very ends of the DNA strand for a double strand break.

Telemetry

Telemetry is the in situ collection of measurements or other data at remote points and their automatic transmission to receiving equipment (telecommunication) for monitoring.[1] The word is derived from the Greek roots tele, "remote", and metron, "measure". Systems that need external instructions and data to operate require the counterpart of telemetry, telecommand.[2]

Although the term commonly refers to wireless data transfer mechanisms (e.g., using radio, ultrasonic, or infrared systems), it also encompasses data transferred over other media such as a telephone or computer network, optical link or other wired communications like power line carriers. Many modern telemetry systems take advantage of the low cost and ubiquity of GSM networks by using SMS to receive and transmit telemetry data.

A telemeter is a physical device used in telemetry. It consists of a sensor, a transmission path, and a display, recording, or control device. Electronic devices are widely used in telemetry and can be wireless or hard-wired, analog or digital. Other technologies are also possible, such as mechanical, hydraulic and optical.[3]

Telemetry may be commutated to allow the transmission of multiple data streams in a fixed frame

Transposable element

A transposable element (TE, transposon, or jumping gene) is a DNA sequence that can change its position within a genome, sometimes creating or reversing mutations and altering the cell's genetic identity and genome size.

Transposons: The Jumping Genes

By: Leslie A. Pray, Ph.D. © 2008 Nature Education 
Citation: Pray, L. (2008) Transposons: The jumping genes. Nature Education 1(1):204
 
Frog is an unincorporated community in Kaufman County, located in the U.S. state of Texas.
genomics

Scientists Catch Jumping Genes Rewiring Genomes

Transcription factors that act throughout the genome can arise from mashups of transposable elements inserted into established genes.

NMDA receptor

The N-methyl-D-aspartate receptor (also known as the NMDA receptor or NMDAR), is a glutamate receptor and ion channel found in neurons. The NMDA receptor is one of three types of ionotropic glutamate receptors, the other two being AMPA and kainate receptors. Depending on its subunit composition, its ligands are glutamate and glycine (or D-serine). However, the binding of the ligands is typically not sufficient to open the channel as it may be blocked by Mg2+ ions which are only removed when the neuron is sufficiently depolarized. Thus, the channel acts as a “coincidence detector” and only once both of these conditions are met, the channel opens and it allows positively charged ions (cations) to flow through the cell membrane.[2] The NMDA receptor is thought to be very important for controlling synaptic plasticity and mediating learning and memory functions.[3]

The NMDA receptor is ionotropic, meaning it is a protein which allows the passage of ions through the cell membrane.[4] The NMDA receptor is so named because the agonist molecule N-methyl-D-aspartate (NMDA) binds selectively to it, and not to other glutamate receptors. Activation of NMDA receptors results in the opening of the ion channel that is nonselective to cations, with a combined reversal potential near 0 mV. While the opening and closing of the ion channel is primarily gated by ligand binding, the current flow through the ion channel is voltage-dependent. Extracellular magnesium (Mg2+) and zinc (Zn2+) ions can bind to specific sites on the receptor, blocking the passage of other cations through the open ion channel. Depolarization of the cell dislodges and repels the Mg2+ and Zn2+ ions from the pore, thus allowing a voltage-dependent flow of sodium (Na+) and calcium (Ca2+) ions into the cell and potassium (K+) out of the cell.[5][6][7][8] Ca2+ flux through NMDA receptors in particular is thought to be critical in synaptic plasticity, a cellular mechanism for learning and memory, due to proteins which bind to and are activated by Ca2+ ions.

The activity of the NMDA receptor is affected by many psychoactive drugs such as phencyclidine (PCP), alcohol (ethanol) and dextromethorphan (DXM). The anaesthetic and analgesic effects of the drugs ketamine and nitrous oxide are partially due to their effects on NMDA receptor activity. However, overactivation of NMDAR increases the cytosolic concentrations of calcium and zinc, which significantly contributes to neural death, that is found to be prevented by cannabinoids, with requirement of a HINT1 protein to counteract the toxic effects of NMDAR-mediated NO production and zinc release, through activation of the CB1 receptor.[9] As well as preventing methamphetamine (Meth) induced neurotoxicity via inhibition of nitric oxide synthase (nNOS) expression and astrocyte activation, is seen to reduce methamphetamine induced brain damage through a CB1-dependent and independent mechanisms, respectively, and inhibition of methamphetamine induced astrogliosis is likely to occur through a CB2 receptor dependent mechanism for THC.[10] Since 1989, memantine has been recognized to be an uncompetitive antagonist of the NMDA receptor, entering the channel of the receptor after it has been activated and thereby blocking the flow of ions.[11][12][13]

What is NMDA?

Microsoft's Software is Malware


Nonfree (proprietary) software is very often malware (designed to mistreat the user). Nonfree software is controlled by its developers, which puts them in a position of power over the users; that is the basic injustice. The developers and manufacturers often exercise that power to the detriment of the users they ought to serve.

This typically takes the form of malicious functionalities.

How to Stop Windows 10 From Spying on You

Spybot Anti-Beacon

Tejas, Tejās: 22 definitions

Involvement of the NMDA System in Learning and Memory

What God, Quantum Mechanics and Consciousness Have in Common

Theories that try to explain these big metaphysical mysteries fall short, making agnosticism the only sensible stance

3D Modeling Programs

A Specific Role of Hippocampal NMDA Receptors and Arc Protein in Rapid Encoding of Novel Environmental Representations and a More General Long-Term Consolidation Function

Putting on a show for peeping Tom's

NMDA receptors, place cells and hippocampal spatial memory

Raiders of the lost ARC Gene
Activity-regulated cytoskeleton-associated protein is a plasticity protein that in humans is encoded by the ARC gene
 
Arc virus
Arc forms structures (capsids) that resemble viruses, but can contain and transport RNA. Beyond just encapsulating its own RNA, Arc capsids can take up seemingly any abundant nearby RNA, a process that has also been shown to occur in retroviruses. So, just like viruses, Arc capsids encapsulate and protect RNA.

Are our memories formed by an ancient virus?

Arc, a key protein in memory formation, looks and behaves like a retrovirus, moving RNA between cells in a virus-like capsid. Elissa Pastuzyn explains how this extraordinary protein ended up in our genome

Memory and the NMDA Receptors

Word (computer architecture)

What the heck is a time crystal, and why are physicists obsessed with them?

Some of today’s quantum physicists are tinkering with an esoteric phase of matter that seems to disobey some of our laws of physics.

A step-by-step guide for creating advanced Python data visualizations with Seaborn / Matplotlib

Although there’re tons of great visualization tools in Python, Matplotlib + Seaborn still stands out for its capability to create and customize all sorts of plots.

A role for NMDA-receptor channels in working memory

Just move your mouse and click this URL

Asynchronous release sites align with NMDA receptors in mouse hippocampal synapses

Gut check

Scientists discover a “mind-blowing” link between gut health and age reversal

“By restoring health in the microbiome we’re able to reverse age-related cognitive deficits,” scientists say about their new study in mice

Hey, There's a Second Brain in Your Gut

Have you checked within your mathematical pair of pants as well?

Prehistoric Viruses and the Function of the Brain

The exceedingly strange story of learning, memory and the “Arc” gene

A meme (/mm/ MEEM)[1][2][3] is an idea, behavior, or style that spreads by means of imitation from person to person within a culture and often carries symbolic meaning representing a particular phenomenon or theme.[4] A meme acts as a unit for carrying cultural ideas, symbols, or practices, that can be transmitted from one mind to another through writing, speech, gestures, rituals, or other imitable phenomena with a mimicked theme. Supporters of the concept regard memes as cultural analogues to genes in that they self-replicate, mutate, and respond to selective pressures.[5]

Memory corruption

What Is an Economic Moat?

Memory corruption bugs occur when a program's memory is modified by an attacker in a way that was not intended by the original program. This modification can lead to serious security vulnerabilities, including allowing an attacker to leak sensitive information or execute arbitrary code

Kind of like a dance...

Heisenbug

in context of

Exploiting memory corruption vulnerabilities on Android

Ruby Tuesday FX Arbitrage Bond Market 007 Who done it as a Cryptocurrency exploitation of money/memory hacking

Buffer overflow

Memory gene goes viral

NIH-funded research reveals novel method for transferring genetic material between neurons

Google wants to help improve memory safety in Linux kernel

Capital Factory Austin Texas has recieved my triangular arbitrage pitch. 

How an Ancient Virus Spread the Ability to Remember

— Genetics may hold the key to human cognition 

Remember remembering?  - Davy Crockett

The GluN2A Subunit Regulates Neuronal NMDA receptor-Induced Microglia-Neuron Physical Interactions

Computational mimicry of neural science

What is a Perceptron?

Ark of the Covenant

Attention? Attention!


Keepers of the Lost Ark?

Christians in Ethiopia have long claimed to have the ark of the covenant. Our reporter investigated

 
Neuropsychologist Donald Hebb first used this phrase in 1949 to describe how pathways in the brain are formed and reinforced through repetition. 

Brownian motor

Examples in nature

In biology, much of what we understand to be protein-based molecular motors may also in fact be Brownian motors. These molecular motors facilitate critical cellular processes in living organisms and, indeed, are fundamental to life itself.

Researchers have made significant advances in terms of examining these organic processes to gain insight into their inner workings. For example, molecular Brownian motors in the form of several different types of protein exist within humans. Two common biomolecular Brownian motors are ATP synthase, a rotary motor, and myosin II, a linear motor.[11] The motor protein ATP synthase produces rotational torque that facilitates the synthesis of ATP from Adenosine diphosphate (ADP) and inorganic phosphate (Pi) through the following overall reaction:

ADP + Pi + 3H+out ⇌ ATP + H2O + 3H+in

In contrast, the torque produced by myosin II is linear and is a basis for the process of muscle contraction.[11] Similar motor proteins include kinesin and dynein, which all convert chemical energy into mechanical work by the hydrolysis of ATP. Many motor proteins within human cells act as Brownian motors by producing directed motion on the nanoscale, and some common proteins of this type are illustrated by the following computer-generated images.

  • Proteins acting as Brownian motors inside human cells

 ATP Synthase
Myosin II

Brownian motion

Putting it together

MSTN gene

myostatin

The MSTN gene provides instructions for making a protein called myostatin. This protein is part of the transforming growth factor beta (TGFβ) superfamily, which is a group of proteins that help control the growth and development of tissues throughout the body. Myostatin is found almost exclusively in muscles used for movement (skeletal muscles), where it is active both before and after birth. This protein normally restrains muscle growth, ensuring that muscles do not grow too large. Myostatin has been studied extensively in mice, cows, and other animals, and it appears to have a similar function in humans.

Researchers are studying myostatin as a potential treatment for various muscular dystrophies that cause muscle weakness and wasting (atrophy).

Myostatin

Myostatin (also known as growth differentiation factor 8, abbreviated GDF8) is a myokine, a protein produced and released by myocytes that acts on muscle cells to inhibit muscle cell growth. In humans it is encoded by the MSTN gene.[6] Myostatin is a secreted growth differentiation factor that is a member of the TGF beta protein family.[7][8]

Animals either lacking myostatin or treated with substances that block the activity of myostatin have significantly more muscle mass. Furthermore, individuals who have mutations in both copies of the myostatin gene have significantly more muscle mass and are stronger than normal. There is hope that studies into myostatin may have therapeutic application in treating muscle wasting diseases such as muscular dystrophy.[9]

Dominance (genetics)

...

Dominance is not inherent to an allele or its traits (phenotype). It is a strictly relative effect between two alleles of a given gene of any function; one allele can be dominant over a second allele of the same gene, recessive to a third and co-dominant with a fourth. Additionally, one allele may be dominant for one trait but not others.

Dominance is a key concept in Mendelian inheritance and classical genetics. Letters and Punnett squares are used to demonstrate the principles of dominance in teaching, and the use of upper case letters for dominant alleles and lower case letters for recessive alleles is a widely followed convention. A classic example of dominance is the inheritance of seed shape in peas. Peas may be round, associated with allele R, or wrinkled, associated with allele r. In this case, three combinations of alleles (genotypes) are possible: RR, Rr, and rr. The RR (homozygous) individuals have round peas, and the rr (homozygous) individuals have wrinkled peas. In Rr (heterozygous) individuals, the R allele masks the presence of the r allele, so these individuals also have round peas. Thus, allele R is dominant over allele r, and allele r is recessive to allele R.

Allele

For string algorithms, see String (computer science). For other uses, see String (disambiguation).
For a more accessible and less technical introduction to this topic, see Introduction to M-theory.

How Steven Weinberg Transformed Physics and Physicists

When Steven Weinberg died last month, the world lost one of its most profound thinkers.

Steven Weinberg

Views on religion

Weinberg was an atheist.[46] He stated his views on religion in 1999:

Frederick Douglass told in his Narrative how his condition as a slave became worse when his master underwent a religious conversion that allowed him to justify slavery as the punishment of the children of Ham. Mark Twain described his mother as a genuinely good person, whose soft heart pitied even Satan, but who did not doubt the legitimacy of slavery, because in years of living in antebellum Missouri she had never heard any sermon opposing slavery, but only countless sermons preaching that slavery was God's will. With or without religion, good people can behave well and bad people can do evil; but for good people to do evil—that takes religion.[47][full citation needed]

Before he was an advocate of the Big Bang theory, Weinberg stated:[48]

The steady-state theory is philosophically the most attractive theory because it least resembles the account given in Genesis.

Wilson, Robert Anton - Masks of the Illuminati

Masks of the Illuminati by Robert Anton Wilson

Ham (son of Noah)

He finds the man is possessed by a multitude of demons who give the collective name of "Legion". Fearing that Jesus will drive them out of the world and into the abyss, they beg him instead to send them into a herd of pigs, which he does. The pigs then rush into the sea and are drowned (Mark 5:1–5:13).
Where does the term being a ham come from?

The word Ham to mean an "overacting inferior performer," apparently dates from about 1882 and orignates from American English. Originally the word was hamfatter, meaning "actor of low grade," and has been linked to an old minstrel show song, "The Ham-fat Man" which dates from about 1863.

Ham, Hamlet, PiggyBac transposon system, Piggybacking (data transmissions) Piggybacking (marketing)

Hamlet: A Monologue

Synopsis
A video recording of a performance of theatre designer Robert Wilson’s performance-piece HAMLET: A MONOLOGUE. Wilson, working with Wolfgang Wiens’ text, performs Hamlet as a monologue in 15 scenes. He interprets not only Hamlet, but other characters too. Pulling props and costume pieces out of a trunk in the style of classic story theatre; Wilson also interprets Gertrude, Rosencrantz, Guildenstern and Ophelia.

[Hamletmaschine]

By Heiner Müller

Gauge symmetry (mathematics)

Force field (chemistry)

PiggyBac transposon system

Piggybacking (data transmission)

In two-way communication, whenever a frame is received, the receiver waits and does not send the control frame (acknowledgement or ACK) back to the sender immediately.

The receiver waits until its network layer passes in the next data packet. The delayed acknowledgement is then attached to this outgoing data frame.

This technique of temporarily delaying the acknowledgement so that it can be hooked with next outgoing data frame is known as piggybacking.

Working (capital) Principle

Piggybacking data is a bit different from Sliding Protocol used in the OSI model. In the data frame itself, we incorporate one additional field for acknowledgment (called ACK).

Whenever party A wants to send data to party B, it will carry additional ACK information in the PUSH as well.

For example, if A has received 5 bytes from B, which sequence number starts from 12340 (through 12344), A will place "ACK 12345" as well in the current PUSH packet to inform B it has received the bytes up to sequence number 12344 and expects to see 12345 next time. (ACK number is the next sequence number of the data to be PUSHed by the other party.)

Three rules govern the piggybacking data transfer.

  • If station A wants to send both data and an acknowledgment, it keeps both fields there.
  • If station A wants to send the acknowledgment, after a short period of time to see whether a data frame needs to be sent, then decide whether send an ACK frame alone or attach a data frame with it.
  • If station A wants to send just the data, then the previous acknowledgment field is sent along with the data. Station B simply ignores this duplicate ACK frame upon receiving.

Advantages and Disadvantages

Advantages : Improves the efficiency, better use of available channel bandwidth.[1] Disadvantages : The receiver can jam the service if it has nothing to send. This can be solved by enabling a counter (Receiver timeout) when a data frame is received. If the count ends and there is no data frame to send, the receiver will send an ACK control frame. The sender also adds a counter (Emitter timeout), if the counter ends without receiving confirmation, the sender assumes packet loss, and sends the frame again.

References


Tanenbaum, Andrew & Wetherall, David. Computer Networks, 5th Edition, Pearson Education Limited, , 2014, p 226

The Information Age (also known as the Computer Age, Digital Age, or New Media Age) is a historical period that began in the mid-20th century, characterized by a rapid epochal shift from the traditional industry established by the Industrial Revolution to an economy primarily based upon information technology.

The Information Age was enabled by technology developed in the Digital Revolution, which was itself enabled by building on the developments of the Technological Revolution.

Transistors

Further information: Semiconductor device

Economics

Eventually, Information and communication technology (ICT)—i.e. computers, computerized machinery, fiber optics, communication satellites, the Internet, and other ICT tools—became a significant part of the world economy, as the development of microcomputers greatly changed many businesses and industries.[20][21] Nicholas Negroponte captured the essence of these changes in his 1995 book, Being Digital, in which he discusses the similarities and differences between products made of atoms and products made of bits.[22] In essence, a copy of a product made of bits can be made cheaply and quickly, then expediently shipped across the country or the world at very low cost.

Jobs and income distribution

The Information Age has affected the workforce in several ways, such as compelling workers to compete in a global job market. One of the most evident concerns is the replacement of human labor by computers that can do their jobs faster and more effectively, thus creating a situation in which individuals who perform tasks that can easily be automated are forced to find employment where their labor is not as disposable.[23] This especially creates issue for those in industrial cities, where solutions typically involve lowering working time, which is often highly resisted. Thus, individuals who lose their jobs may be pressed to move up into joining "mind workers" (e.g. engineers, doctors, lawyers, teachers, professors, scientists, executives, journalists, consultants), who are able to compete successfully in the world market and receive (relatively) high wages.[24]

Along with automation, jobs traditionally associated with the middle class (e.g. assembly line, data processing, management, and supervision) have also begun to disappear as result of outsourcing.[25] Unable to compete with those in developing countries, production and service workers in post-industrial (i.e. developed) societies either lose their jobs through outsourcing, accept wage cuts, or settle for low-skill, low-wage service jobs.[25] In the past, the economic fate of individuals would be tied to that of their nation's. For example, workers in the United States were once well paid in comparison to those in other countries. With the advent of the Information Age and improvements in communication, this is no longer the case, as workers must now compete in a global job market, whereby wages are less dependent on the success or failure of individual economies.[25]

In effectuating a globalized workforce, the internet has just as well allowed for increased opportunity in developing countries, making it possible for workers in such places to provide in-person services, therefore competing directly with their counterparts in other nations. This competitive advantage translates into increased opportunities and higher wages.[26]

Automation, productivity, and job gain

The Information Age has affected the workforce in that automation and computerisation have resulted in higher productivity coupled with net job loss in manufacturing. In the United States, for example, from January 1972 to August 2010, the number of people employed in manufacturing jobs fell from 17,500,000 to 11,500,000 while manufacturing value rose 270%.[27]

Although it initially appeared that job loss in the industrial sector might be partially offset by the rapid growth of jobs in information technology, the recession of March 2001 foreshadowed a sharp drop in the number of jobs in the sector. This pattern of decrease in jobs would continue until 2003,[28] and data has shown that, overall, technology creates more jobs than it destroys even in the short run.[29]

Information-intensive industry

Main article: Information industry

Industry has become more information-intensive while less labor- and capital-intensive. This has left important implications for the workforce, as workers have become increasingly productive as the value of their labor decreases. For the system of capitalism itself, not only is the value of labor decreased, the value of capital is also diminished.

In the classical model, investments in human and financial capital are important predictors of the performance of a new venture.[30] However, as demonstrated by Mark Zuckerberg and Facebook, it now seems possible for a group of relatively inexperienced people with limited capital to succeed on a large scale.[31]

Gene duplication

Tandem exon duplication is defined as duplication of exons within the same gene to give rise to the subsequent exon. A complete exon analysis of all genes in Homo sapiens, Drosophila melanogaster, and Caenorhabditis elegans has shown 12,291 instances of tandem duplication in exons in human, fly, and worm. Analysis of the intronic region has produced further 4,660 unidentified duplicated exons referred to as unannotated exons. 1,578 of these unannotated exons contained stop codons thus not considered potential exons. 35.1% of the unannotated exons were found in the EST sequence thus confirming the potential of the presence of these exons in protein transcripts.[1]

Insertion of the IL1RAPL1 gene into the duplication junction of the dystrophin gene

Transcriptional Behavior of DMD Gene Duplications in DMD/BMD Males F. Gualandi1, M.Neri 1, M. Bovolenta1, E. Martoni1, P. Rimessi1, S. Fini1, P. Spitali1, M. Fabris1, M. Pane2, C. Angelini3, M. Mora4, L. Morandi4, T. Mongini 5, E. Bertini6, E. Ricci7, G. Vattemi8, E. Mercuri9, L. Merlini1, and A. Ferlini

Tandem duplications of two separate fragments of the dystrophin gene in a patient with Duchenne muscular dystrophy

Italy
Spain
Researching a cure for muscular dystrophy Austin Texas, USA

Palindrome

Palindromic sequence

A method to find palindromes in nucleic acid sequences

Ramnath Anjana,$ Mani Shankar,$ Marthandan Kirti Vaishnavi, and Kanagaraj Sekar*

Structural Biochemistry/Nucleic Acid/DNA/Palindromic Sequencing 

Fibrifold

In mathematics, a fibrifold is (roughly) a fiber space whose fibers and base spaces are orbifolds.  

String (computer science)

Do not Fret Carole Zoom, especially on a Fretless bass.

String theory

Pappy, look at that... DNA strands are composed of Nitrogenous bases.Stem Cells

GAP-Seq: a method for identification of DNA palindromes

Structure-based combinatorial protein engineering

Structure-based combinatorial protein engineering (SCOPE)

A reference catalog of DNA palindromes in the human genome and their variations in 1000 Genomes

The Contribution of Patient-Specific Induced PluripotentStem Cell Technology to Regenerative Rehabilitation

Duchenne Muscular Dystrophy (DMD)

What is Duchenne muscular dystrophy?

COL4A6 collagen type IV alpha 6 chain [ Homo sapiens (human) ]

Wellstone Muscular Dystrophy Research Network

Established as part of the NIH enhancement and intensification of muscular dystrophy research associated with the MD-CARE Act, the centers are supported by five-year, renewable grants.

Myoediting Core/Duchenne Skipper Database

The UT Southwestern Wellstone Myoediting Core will provide a unique, efficient, cost-effective, and collaborative molecular biology resource to be shared by the entire Wellstone Network. Focusing on DMD, the Wellstone Myoediting Core will provide an immediately accessible resource for Wellstone Network physicians and scientists to obtain CRISPR/Cas9 myoediting tools, technology and expertise to functionally rescue dystrophin expression in their own patient’s cells grown as iPSC-derived “DMD-in-a-dish” skeletal and cardiac muscle cell cultures. 
A statement of work (SOW) is a document routinely employed in the field of project management. It is the narrative description of a project's work requirement.[1] It defines project-specific activities, deliverables and timelines for a vendor providing services to the client. The SOW typically also includes detailed requirements and pricing, with standard regulatory and governance terms and conditions. It is often an important accompaniment to a master service agreement or request for proposal (RFP).

Nanozymes

Nanozyme: new horizons for responsive biomedical applications

Dawei Jiang,a,b Dalong Ni,a Zachary T. Rosenkrans,a Peng Huang,b Xiyun Yan,c and Weibo Caia

Scleroprotein

Ribozyme

Membrane protein

Proteasome

Site-Selective RNA Splicing Nanozyme: Dnazyme and RTCB Conjugates on a Gold Nanoparticle

  • Jessica R. Petree
  • Kevin Yehl
  • Kornelia Galior
  • Roxanne Glazier
  • Brendan Deal
 
 

Hypersurface

Born–Oppenheimer approximation with correct symmetry

Franck–Condon principle

Lattice Boltzmann methods

Fokker–Planck equation

Boltzmann equation

Chemical equilibrium

BBGKY hierarchy

kCSD-python, a tool for reliable current source density estimation
Chaitanya Chintaluri1,2,, Marta Kowalska1,, Władysław Średniawa1,3, Michał
Czerwiński1, Jakub M. Dzik1, Joanna Jędrzejewska-Szmek1, Daniel K. Wójcik1,*

kCSD-python, meet DOPE, implemented in python...

DOPE, or Discrete Optimized Protein Energy, is a statistical potential used to assess homology models in protein structure prediction. DOPE is based on an improved reference state that corresponds to noninteracting atoms in a homogeneous sphere with the radius dependent on a sample native structure; it thus accounts for the finite and spherical shape of the native structures. It is implemented in the popular homology modeling program MODELLER and used to assess the energy of the protein model generated through many iterations by MODELLER, which produces homology models by the satisfaction of spatial restraints. The models returning the minimum molpdfs can be chosen as best probable structures and can be further used for evaluating with the DOPE score. Like the current version of the MODELLER software, DOPE is implemented in Python and is run within the MODELLER environment. The DOPE method is generally used to assess the quality of a structure model as a whole. Alternatively, DOPE can also generate a residue-by-residue energy profile for the input model, making it possible for the user to spot the problematic region in the structure model.

MODELLER is used for homology or comparative modeling of protein three-dimensional structures 

Installation

for

Homology (mathematics)

Topology

How Mathematicians Use Homology

Originally devised as a rigorous means of counting holes, homology provides a scaffolding for mathematical ideas, allowing for a new way to analyze the shapes within data.

FokI

Having supplied restriction enzymes to the research community for over 45 years, NEB has earned the reputation of being the leader in enzyme technologies.  

Nuclease

Gene therapy

Transcription activator-like effector nuclease

Jack William Szostak FRS (born November 9, 1952)[1] is a Canadian American[2] biologist of Polish British descent, Nobel Prize laureate, Professor of Genetics at Harvard Medical School, and Alexander Rich Distinguished Investigator at Massachusetts General Hospital, Boston. Szostak has made significant contributions to the field of genetics. His achievement helped scientists to map the location of genes in mammals and to develop techniques for manipulating genes. His research findings in this area are also instrumental to the Human Genome Project. He was awarded the 2009 Nobel Prize for Physiology or Medicine, along with Elizabeth Blackburn and Carol W. Greider, for the discovery of how chromosomes are protected by telomeres

Zwitterion

How To Create a Twitter App and API Interface Via Python

Dynamical mean-field theory

Mean-field theory

Dimer (chemistry)

Protein dimer

Reagent

Substrate (chemistry)

Scalar field

Hessian matrix


and from NASA
A low-power, and compact nanosensor array chip

Caspar Wessel



What is a dictionary in programming?

A dictionary is a general-purpose data structure for storing a group of objects. A dictionary has a set of keys and each key has a single associated value. ... A dictionary is also called a hash, a map, a hashmap in different programming languages (and an Object in JavaScript).

Library (computing)

Spherical trigonometry

Transfection

Use the Schwartz Luke 11:11 in a  Priestley space

 
Schwarz triangle

Use the Schwartz

Glueball

Penrose tiling

Riemann sphere

Hopf fibration

Myosin fiber modeling for Monty Python
associative array, map, symbol table, or dictionary

Structural genomics

An adparticle is an atom, molecule, or cluster of atoms or molecules that lies on a crystal surface. The term is used in surface chemistry. The word is a contraction of "adsorbed particle". An adparticle that is a single atom may be referred to as an "adatom".

In bioinformatics, clique-finding algorithms have been used to infer evolutionary trees, predict protein structures, and find closely interacting clusters of proteins.

Our Mission

The mission of the National Institute of Arthritis and Musculoskeletal and Skin Diseases is to support research into the causes, treatment, and prevention of arthritis and musculoskeletal and skin diseases; the training of basic and clinical scientists to carry out this research; and the dissemination of information on research progress in these diseases.

Dera Tompkins

Biomedical Librarian

Dera Tompkins is a Biomedical Librarian at the NIH Library at the National Institutes of Health. She previously served as a Medical Librarian at the Neuroscience Reseach Center, NIMH.

Library (computing)

ADA Austin Disparity, Austin Ballet, All American game of Baseball...
...four naturally occurring nitrogenous bases
DNA nucleotides: adenine (A), thymine (T), guanine (G), and cytosine (C)
(costume considerations for the arts, E-Textiles)

Biowulf is intended to run code programmed by our users as well as commercial and open-source codes that may need to be built for our platform(s) if they do not come in a useable binary format. Accordingly, we host a number of compilers and build environments to suit the needs of developers and individuals that need to build projects from source.

This page provides information specific to the Biowulf development environment as well as a rough overview of the various compilers, libraries and programs used on our system. The linked documentation on specific packages and programs will usually need to be consulted for any useful understanding of them.

Library Workspaces

Data Analysis, Processing, and Visualization Tools

What's Available at the NIH Library

Office of Computer and Communications Systems

OCCS Mission

The Office of Computer and Communications Systems (OCCS) provides efficient, cost-effective computing and networking services, technical advice, and collaboration in informational sciences in support of the research and management programs offered through NLM.

OCCS develops and provides the NLM backbone computer networking facilities, and supports, guides, and assists other NLM components in local area networking. The Division provides professional programming services and computational and data processing facilities to meet NLM program needs; operates and maintains the NLM Computer Center; designs and develops software; and provides extensive customer support, training courses and seminars, and documentation for computer and network users.

OCCS helps to coordinate, integrate, and standardize the vast array of computer services available throughout all of the organizations comprising NLM. The Division also serves as a technological resource for other parts of the National Library of Medicine (NLM) and for other Federal organizations with biomedical, statistical, and administrative computing needs.

The Division promotes the application of High Performance Computing and Communication to biomedical problems, including image processing.

The OCCS staff develops computer-based systems for information retrieval applications, conducts computer science and engineering research and development, and consults and collaborates in the area of advanced electronic office automation facilities. They support software systems to perform these services, and conduct research and evaluations for best fit solutions to information access needs.

Biowulf Training Videos

Autosomal DNA statistics

Rfam is designed to be similar to the Pfam database for annotating protein families.

Gene family

Eagle's minimal essential medium

Molecular switch

Molecular biology

Molecular geometry

Molecular Psychiatry

Industrial and organizational psychology

Job scheduler

Schooliosis, a pun on "school" and "scoliosis", is a term for a type of medical misdiagnosis. The word was coined by Petr Skrabanek and James McCormick.[1]

The authors asserted that there is some degree of overdiagnosis of scoliosis in school, which causes ethical, social, and economic damage to the welfare of children.[2] Such overdiagnosis is called "schooliosis" by some academics. Schooliosis is a type of disease mongering.[3]

Preventive medical screening in school or college may lead to an incorrect diagnosis of scoliosis that triggers a series of unnecessary medical interventions on adolescents. There can be diagnostic and therapeutic cascades involving several specialists, which can end with iatrogenic damage to a healthy child with a normal back. The risks are unnecessary overexposure to X-rays (repeated diagnostic X-rays), rehabilitation techniques with side effects (traction), stigmatizing orthopaedic treatment (braces for back injury) and costs in time, travel, etc.[4]

The term has also been used in a non-medical sense for students' inability to imagine themselves as graduates.

The Martha Mitchell effect is the process by which a psychiatrist, psychologist, other mental health clinician, or a medical professional, labels the patient's accurate perception of real events as delusional and misdiagnoses accordingly.

According to Bell et al., "Sometimes, improbable reports are erroneously assumed to be symptoms of mental illness", due to a "failure or inability to verify whether the events have actually taken place, no matter how improbable intuitively they might appear to the busy clinician".

Clinical iatrogenesis is the injury done to patients by ineffective, toxic, and unsafe treatments.

Social iatrogenesis refers to the process by which 'medical practice sponsors sickness by reinforcing a morbid society that encourages people to become consumers of curative, preventive, industrial and environmental medicine'.

Third, cultural iatrogenesis refers to the destruction of traditional ways of dealing with, and making sense of, death, suffering, and sickness. In this way the medicalization of life leads to cultural harm as society members lose their autonomous coping skills.

Abusive power and control (also controlling behavior and coercive control) is the way that an abusive person gains and maintains power and control over another person in order to subject that victim to psychological, physical, sexual, or financial abuse. The motivations of the abuser are varied and can include devaluation, envy, personal gain, personal gratification, psychological projection, or just for the sake of the enjoyment of exercising power and control.

Disease mongering

Disease mongering is a term for the practice of widening the diagnostic boundaries of illnesses and aggressively promoting their public awareness in order to expand the markets for treatment. Among the entities benefiting from selling and delivering treatments are pharmaceutical companies, physicians, alternative practitioners and other professional or consumer organizations. It is distinct from the promulgation of bogus or unrecognised diagnoses.

Selling sickness: the pharmaceutical industry and disease mongering

Ray Moynihan, journalist,a Iona Heath, general practitioner,b and David Henry, professor of clinical pharmacology

Job 13 : 4
You cover up your ignorance with lies; you are like doctors who can't heal anyone.

Knock (French title: Knock ou le Triomphe de la médecine) is a 1923 French satirical play about hypochondria, written by Jules Romains. It was performed for the first time at the Théâtre des Champs-Élysées in Paris on 15 December 1923 in a production by Louis Jouvet.

The ambitious Dr. Knock arrives in a rural village, Saint-Maurice, to step into Dr. Parpalaid's footsteps as the local physician. Unfortunately, the villagers are all in good health, which makes Knock realize that he has been duped by Parpalaid. He therefore decides to make everybody believe they are actually far sicker then they actually are...

Proverbs 17 : 23 Corrupt judges accept secret bribes, and then justice is not done.

GRAHAM THORNICROF T, DIANA ROSE, ALIYA KASSAMGRAHAM THORNICROF T, DIANA ROSE, ALIYA KASSAMandand NORMAN SARTORIUSNORMAN SARTORIUS

take (something) on faith

To accept something without further verifying or investigating, based on trust.

Bad faith is double mindedness or double heartedness in duplicity, fraud, or deception. It may involve intentional deceit of others, or self-deception. The expression "bad faith" is associated with "double heartedness", which is also translated as "double mindedness".
 

The Hungarian-American psychiatrist and writer Thomas Szasz, who has died aged 92, was regarded by many as the leading 20th- and 21st-century moral philosopher of psychiatry and psychotherapy

The Myth of Mental Illness: Foundations of a Theory of Personal Conduct is a 1961 book by the psychiatrist Thomas Szasz, in which the author criticizes psychiatry and argues against the concept of mental illness.

Orchestration (computing)

Remembering the Perez Orchestra

1 Chronicles 13

Bringing Back the Ark

"Perez-uzzah"

Emergence

In philosophy, systems theory, science, and art, emergence occurs when an entity is observed to have properties its parts do not have on their own, properties or behaviors which emerge only when the parts interact in a wider whole.

Emergence plays a central role in theories of integrative levels and of complex systems. For instance, the phenomenon of life as studied in biology is an emergent property of chemistry, and psychological phenomena emerge from the neurobiological phenomena of living things.

In philosophy, theories that emphasize emergent properties have been called emergentism.[1]

Got a light?

Luciferin

Who swallowed the GloFish for a MIA experiment?

Magnetic immunoassay (MIA) is a novel type of diagnostic immunoassay using magnetic beads as labels in lieu of conventional enzymes (ELISA), radioisotopes (RIA) or fluorescent moieties (fluorescent immunoassays)[1] to detect a specified analyte.MIA involves the specific binding of an antibody to its antigen, where a magnetic label is conjugated to one element of the pair.The presence of magnetic beads is then detected by a magnetic reader (magnetometer) which measures the magnetic field change induced by the beads. The signal measured by the magnetometer is proportional to the analyte (virus, toxin, bacteria, cardiac marker, etc.) concentration in the initial sample.

Remember kids,

A spin ice is a magnetic substance that does not have a single minimal-energy state. It has magnetic moments (i.e. "spin") as elementary degrees of freedom which are subject to frustrated interactions.

Optogenetics

Optogenetics is a biological technique that involves the use of light to control neurons that have been genetically modified to express light-sensitive ion channels. As such, optogenetics is a neuromodulation method that uses a combination of techniques from optics and genetics to control the activities of individual neurons in living tissue — even within freely-moving animals.[1] In some usages, optogenetics also refers to optical monitoring of neuronal activity[1] or control of other biochemical pathways in non-neuronal cells (see "Cellular biology/cell signaling pathways" section below),[2] although these research activities preceded the use of light-sensitive ion channels in neurons.[3][4] As optogenetics is used by some authors to refer to only optical control of the activity of genetically defined neurons and not these additional research approaches,[5][6][7] the term optogenetics is an example of polysemy.

Neuronal control is achieved using optogenetic actuators like channelrhodopsin, halorhodopsin, and archaerhodopsin, while optical recording of neuronal activities can be made with the help of optogenetic sensors for calcium (GCaMPs), vesicular release (synapto-pHluorin), neurotransmitters (GluSnFRs), or membrane voltage (Quasars, Accelerated Sensor of Action Potentials, Archons).[8][9] Control (or recording) of activity is restricted to genetically defined neurons and performed in a spatiotemporal-specific manner by light.

In 2010, optogenetics was chosen as the "Method of the Year" across all fields of science and engineering by the interdisciplinary research journal Nature Methods.[10] At the same time, optogenetics was highlighted in the article on "Breakthroughs of the Decade" in the academic research journal Science.[11][12][7]

noun
  1. a person who is from 80 to 89 years old.
Crohn's disease is a type of inflammatory bowel disease (IBD). It causes inflammation of your digestive tract, which can lead to abdominal pain, severe diarrhea, fatigue, weight loss and malnutrition. Inflammation caused by Crohn's disease can involve different areas of the digestive tract in different people. 

ce·li·ac dis·ease
/ˈsēlēˌak dəˌzēz/
noun
noun: coeliac disease; noun: celiac disease
  1. a disease in which the small intestine is hypersensitive to gluten, leading to difficulty in digesting food.

Gut flora

Gut flora or gut microbiota are the microorganisms including bacteria, archaea and fungi that live in the digestive tracts of humans[1] and other animals including insects. The gastrointestinal metagenome is the aggregate of all the genomes of gut microbiota.[2][3] The gut is the main location of human microbiota.[4]


Enthalpy

Relationship to heat 

Concentration

Mole ratio

Empathy

Mole (espionage)

Molar mass distribution

Enthalpy Changes in Reactions

Molar heat capacity

Car–Parrinello molecular dynamics

Conformational entropy

Parallel programming model

Application programming interface key

Domain Name System

The Domain Name System (DNS) is a hierarchical and decentralized naming system for computers, services, or other resources connected to the Internet or a private network. It associates various information with domain names assigned to each of the participating entities. Most prominently, it translates more readily memorized domain names to the numerical IP addresses needed for locating and identifying computer services and devices with the underlying network protocols. By providing a worldwide, distributed directory service, the Domain Name System has been an essential component of the functionality of the Internet since 1985.
DNS belongs to the TCP/IP suite and thus falls under the TCP/IP mode

What are the 7 layers of TCP IP?
  • Physical (e.g. cable, RJ45)
  • Data Link (e.g. MAC, switches)
  • Network (e.g. IP, routers)
  • Transport (e.g. TCP, UDP, port numbers)
  • Session (e.g. Syn/Ack)
  • Presentation (e.g. encryption, ASCII, PNG, MIDI)
  • Application (e.g. SNMP, HTTP, FTP)
In computer science, the concept of network layers is a framework that helps to understand complex network interactions. There are two models that are widely referenced today: OSI and TCP/IP. The concepts are similar, but the layers themselves differ between the two models.

The HyperText Transfer Protocol (HTTP), is the Web's application-layer protocol, is at the heart of the Web. It is defined in [RFC 1945] and [RFC 2616]

Middleware is a software layer situated between applications and operating systems.

Schubert calculus

The objects introduced by Schubert are the Schubert cells, which are locally closed sets in a Grassmannian defined by conditions of incidence of a linear subspace in projective space with a given flag. For details see Schubert variety.

The intersection theory of these cells, which can be seen as the product structure in the cohomology ring of the Grassmannian of associated cohomology classes, in principle allows the prediction of the cases where intersections of cells results in a finite set of points, which are potentially concrete answers to enumerative questions. A supporting theoretical result is that the Schubert cells (or rather, their classes) span the whole cohomology ring.

In detailed calculations the combinatorial aspects enter as soon as the cells have to be indexed. Lifted from the Grassmannian, which is a homogeneous space, to the general linear group that acts on it, similar questions are involved in the Bruhat decomposition and classification of parabolic subgroups (by block matrix).

Putting Schubert's system on a rigorous footing is Hilbert's fifteenth problem.

Schubert variety

Tutorial on
Schubert Varieties and Schubert Calculus

Sara Billey

In graph theory, a branch of mathematics, the kth power Gk of an undirected graph G is another graph that has the same set of vertices, but in which two vertices are adjacent when their distance in G is at most k. Powers of graphs are referred to using terminology similar to that of exponentiation of numbers: G2 is called the square of G, G3 is called the cube of G, etc.
What is a gap in skateboarding?

A gap, as the name suggests, describes a gap between two surfaces that typically have a difference in height. In most cases, there is a kicker or jump ramp at the beginning and at the end of the gap. In street skating, pretty much anything can become a gap when a certain distance or height has to be overcome.

In graph theory and computer science, an adjacency matrix is a square matrix used to represent a finite graph. The elements of the matrix indicate whether pairs of vertices are adjacent or not in the graph.

In the special case of a finite simple graph, the adjacency matrix is a (0,1)-matrix with zeros on its diagonal. If the graph is undirected, the adjacency matrix is symmetric. The relationship between a graph and the eigenvalues and eigenvectors of its adjacency matrix is studied in spectral graph theory.

The adjacency matrix should be distinguished from the incidence matrix for a graph, a different matrix representation whose elements indicate whether vertex–edge pairs are incident or not, and degree matrix which contains information about the degree of each vertex.

Matrix multiplication

The use of matrix multiplication is usually given with graphics initially (scalings, translations, rotations, etc). Then there are more in-depth examples such as counting the number of walks between nodes in a graph using the adjacency graph's power.

A fundamental example is the multivariate chain rule. A basic principle in mathematics is that if a problem is hard, you should try to linearize it so that you can reduce as much of it as possible to linear algebra. Often this means replacing a function with a linear approximation (its Jacobian), and then composition of functions becomes multiplication of Jacobians. But of course there are many other ways to reduce a problem to linear algebra.

Linear discrete dynamical systems, aka recurrence relations, As an example, take the Fibonacci numbers. The formula for them comes directly from this matrix formulation (plus diagonalization). 
 
Matrix multiplication — more specifically, powers of a given matrix A — are a useful tool in graph theory, where the matrix in question is the adjacency matrix of a graph or a directed graph.

More generally, one can interpret matrices as representing (possibly weighted) edges in a directed graph which may or may not have loops, and products of matrices as specifying the total number (or total weight) of all the walks with a given structure, between pairs of vertices.

 
Matrix multiplcation plays an important role in quantum mechanics, and all throughout physics. Examples include the moment of inertia tensor, continuous-time descriptions of the evolution of physical systems using Hamiltonians (especially in systems with a finite number of basis states), and the most general formulation of the Lorentz transformation from special relativity.

General relativity also makes use of tensors, which are a generalization of the sorts of objects which row-vectors, column-vectors, and matrices all are. Very roughly speaking, row- and column-vectors are 'one dimensional' tensors, having only one index for its coefficients, and matrices are 'two dimensional' tensors, having two indices for its coefficients, of two different 'kinds' representing rows and columns — input and output, if you prefer. Tensors allow three or more indices, and to allow more than one index to have the same 'kind'.

Transfer-matrix method

High-dimensional problems in statistical physics can sometimes be solved directly using matrix multiplication,with the best-known example of this trick as the one-dimensional Ising model

What is mime type in HTML?
MIME stands for Multipurpose Internet Mail Extensions. It's a way of identifying files on the Internet according to their nature and format. For example, using the Content-type header value defined in a HTTP response, the browser can open the file with the proper extension/plugin

Mime your own business ...

What is the MIME type for JavaScript?
Although the IETF only considers application/javascript as the standard MIME type for JavaScript, variations do need to be accepted. For instance, Google uses text/javascript

What is NPM Java?
npm (originally short for Node Package Manager) is a package manager for the JavaScript programming language.

Mime

A comprehensive, compact MIME type module.

Fiddler is an HTTP debugging proxy server application originally written by Eric Lawrence, formerly a program manager on the Internet Explorer development team at Microsoft.
Mime your own business indeed...

Qubit

In quantum computing, a qubit (/ˈkjuːbɪt/) or quantum bit (sometimes qbit[citation needed]) is the basic unit of quantum information—the quantum version of the classic binary bit physically realized with a two-state device. A qubit is a two-state (or two-level) quantum-mechanical system, one of the simplest quantum systems displaying the peculiarity of quantum mechanics. Examples include the spin of the electron in which the two levels can be taken as spin up and spin down; or the polarization of a single photon in which the two states can be taken to be the vertical polarization and the horizontal polarization. In a classical system, a bit would have to be in one state or the other. However, quantum mechanics allows the qubit to be in a coherent superposition of both states simultaneously, a property that is fundamental to quantum mechanics and quantum computing.
well
In computing, entropy is the randomness collected by an operating system or application for use in cryptography or other uses that require random data. This randomness is often collected from hardware sources (variance in fan noise or HDD), either pre-existing ones such as mouse movements or specially provided randomness generators. A lack of entropy can have a negative impact on performance and security.
Data transfer rate of synchronous transmission is faster since it transmits in chunks of data, compared to asynchronous transmission which transmits one byte at a time. ... Synchronous transmission is systematic and needs lower overhead compared to asynchronous transmission.
bit  asynchronous , byte synchronous,
bit synchronous, byte asynchronous

An asynchronous communication service or application does not require a constant bit rate. Examples are file transfer, email and the World Wide Web. An example of the opposite, a synchronous communication service, is realtime streaming media, for example IP telephony, IP-TV and video conferencing.

Whereas, in Asynchronous Transmission sender and receiver does not require a clock signal as the data sent here has a parity bit attached to it which indicates the start of the new byte. ... Synchronous Transmission is efficient and has lower overhead as compared to the Asynchronous Transmission

Wolfgang Pauli, Carl Jung, and the Acausal Connecting Principle: A Case Study in Transdisciplinarity


Synchronicity (German: Synchronizität) is a concept, first introduced by analytical psychologist Carl Jung, which holds that events .... Following discussions with both Albert Einstein and Wolfgang Pauli, Jung believed there were parallels

Atom, Archetype, and the Invention of Synchronicity: How Iconic Psychiatrist Carl Jung and Nobel-WinningPhysicist Wolfgang Pauli Bridged Mind and Matter

Two of humanity’s greatest minds explore the parallels between spacetime and the psyche, the atomic nucleus and the self.

 

 

 

 

 

 

 

 

 

 

 

 


 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
 
In particle theory, the skyrmion (/ˈskɜːrmi.ɒn/) is a topologically stable field configuration of a certain class of non-linear sigma models. It was originally proposed as a model of the nucleon by Tony Skyrme in 1962. As a topological soliton in the pion field, it has the remarkable property of being able to model, with reasonable accuracy, multiple low-energy properties of the nucleon, simply by fixing the nucleon radius. It has since found application in solid state physics, as well as having ties to certain areas of string theory.

Quantum jump method

Quantum animism: The Intuition behind Shannon's Entropy
Jung anima/animus
Jung Mask
Java Applications

barycentric

Computes the location of a point in a simplex in barycentric coordinates (aka areal coordinates).

Usage

Install using npm:

npm install barycentric

And then use as follows:

var barycentric = require("barycentric")

console.log(barycentric([[0,0], [0,1], [1,0]], [0.5, 0.5]))
//Prints:
//
//  [0, 0.5, 0.5]
//

Credits

(c) 2013 Mikola Lysenko. MIT License

For a system having a fixed energy, entropy is the logarithm of all possible states that the system can take times the Boltzman constant. That is the definition of entropy statistically. Now entropy is said to be a measure of randomness. ... Thus entropy can be visualized as a measure of randomness.

Information entropy is the average rate at which information is produced by a stochastic source of data.

Perform Weighted Random with JavaScript

Is array a matrix?

We are now ready to discuss two-dimensional arrays, called matrices (singular: matrix). A matrix resembles a table with rows and columns. It is possible for arrays to have multiple dimensions. A three dimensional array, for example, has 3 subscripts, where each dimension is represented as a subscript in the array.

Gell-Mann matrices

The Gell-Mann matrices, developed by Murray Gell-Mann, are a set of eight linearly independent 3×3 traceless Hermitian matrices used in the study of the strong interaction in particle physics. They span the Lie algebra of the SU(3) group in the defining representation.

Low-rank approximation

In mathematics, low-rank approximation is a minimization problem, in which the cost function measures the fit between a given matrix (the data) and an approximating matrix (the optimization variable), subject to a constraint that the approximating matrix has reduced rank. The problem is used for mathematical modeling and data compression. The rank constraint is related to a constraint on the complexity of a model that fits the data. In applications, often there are other constraints on the approximating matrix apart from the rank constraint, e.g., non-negativity and Hankel structure.


In computer science, a graph is an abstract data type that is meant to implement the undirected graph and directed graph concepts from mathematics; specifically, the field of graph theory
An object-relational database (ORD), or object-relational database management system (ORDBMS), is a database management system (DBMS) similar to a relational database, but with an object-oriented database model: objects, classes and inheritance are directly supported in database schemas and in the query language. In addition, just as with pure relational systems, it supports extension of the data model with custom data types and methods.

An object-relational database can be said to provide a middle ground between relational databases and object-oriented databases. In object-relational databases, the approach is essentially that of relational databases: the data resides in the database and is manipulated collectively with queries in a query language; at the other extreme are OODBMSes in which the database is essentially a persistent object store for software written in an object-oriented programming language, with a programming API for storing and retrieving objects, and little or no specific support for querying.

Comparison of cluster software

List of cluster management software

Kubernetes

OpenMP

Jupyter on Biowulf
A relational database is a digital database based on the relational model of data, as proposed by E. F. Codd in 1970.[1] A software system used to maintain relational databases is a relational database management system (RDBMS). Many relational database systems have an option of using the standard SQL (Structured Query Language) for querying and maintaining the database.

Neo4j
System software

Neo4j is a graph database management system developed by Neo4j, Inc. Described by its developers as an ACID-compliant transactional database with native graph storage and processing, Neo4j is the most popular graph database according to DB-Engines ranking, and the 22nd most popular database overall.

MongoDB is a general purpose, document-based, distributed database built for modern application developers and for the cloud era. No database is more productive to use.

Infinispan is a distributed in-memory key/value data store with optional schema, available under the Apache License 2.0.

Parallel Processing and Multiprocessing in Python

Kim A. Sharp, Anthony Nicholls, Richard Friedman, and Barry Honig*
 
What is Java Persistence API used for?
Java Persistence API (JPA) Data Persistence is a means for an application to persist and retrieve information from a non-volatile storage system. Persistence is vital to enterprise applications because of the required access to relational databases.

The Java Persistence API (JPA) is a Java specification that bridges the gap between relational databases and object-oriented programming.

In software engineering, a WAR file (Web Application Resource or Web application ARchive) is a file used to distribute a collection of JAR-files, JavaServer Pages, Java Servlets, Java classes, XML files, tag libraries, static web pages (HTML and related files) and other resources that together constitute a web ..

How do I test if Java is working?
Answer
  1. Open the command prompt. Follow the menu path Start > Programs > Accessories > Command Prompt.
  2. Type: java -version and press Enter on your keyboard. Result: A message similar to the following indicates that Java is installed and you are ready to use MITSIS via the Java Runtime Environment.

Java is supported on Windows, OS X and Linux. It is not supported in iOS or Chrome OS. Java is very much involved in Android, but not in a way that is visible to end users.

https://javatester.org/

What is meant by EJB in Java?

Enterprise JavaBeans (EJB) is the server-side and platform-independent Java application programming interface (API) for Java Platform, Enterprise Edition (Java EE). EJB is used to simplify the development of large distributed applications.

What is a Schemaless database?
1, database schema is the data structure of a database table, in RDBMS, such as MySQL, every database table should have a fixed data structure. Database schema. 2, schema less means the database don't have fixed data structure, such as MongoDB, it has JSON-style data store, you can change the data structure as you wish .

 
 
 

 
 

 

 

Graph database

In computing, a graph database (GDB) is a database that uses graph structures for semantic queries with nodes, edges, and properties to represent and store data. A key concept of the system is the graph (or edge or relationship). The graph relates the data items in the store to a collection of nodes and edges, the edges representing the relationships between the nodes. The relationships allow data in the store to be linked together directly and, in many cases, retrieved with one operation. Graph databases hold the relationships between data as a priority. Querying relationships within a graph database is fast because they are perpetually stored within the database itself. Relationships can be intuitively visualized using graph databases, making them useful for heavily inter-connected data.

Graph databases are part of the NoSQL databases created to address the limitations of the existing relational databases. While the graph model explicitly lays out the dependencies between nodes of data, the relational model and other NoSQL database models link the data by implicit connections. Graph databases, by design, allow simple and fast retrieval[citation needed] of complex hierarchical structures that are difficult to model[according to whom?] in relational systems. Graph databases are similar to 1970s network model databases in that both represent general graphs, but network-model databases operate at a lower level of abstraction[3] and lack easy traversal over a chain of edges.

Again: Java Tester, NoSQL Database for a JPA WAR

Pipeline (computing)

palindrome algorithm javascript

Is Tacocat a palindrome?
tacocat is a palindrome, meaning spelled backwards and forwards its the same.

Longest palindromic substring

How do you check if a word is a palindrome in Python?
Source Code

casefold() # reverse the string rev_str = reversed(my_str) # check if the string is equal to its reverse if list(my_str) == list(rev_str): print("The string is a palindrome.") else: print("The string is not a palindrome.") The string is a palindrome.

By David Vincent Bell Hirsch

Muscular dystrophy in a dish: engineered human skeletal muscle mimetics for disease modeling and drug discovery

Alec S.T. Smith,1 Jennifer Davis,1,2,3,4 Gabsang Lee,5 David L. Mack,3,6 and Deok-Ho Kimcorresponding author1,3,4
July 27, 2020

FDA Approves Targeted Treatment for Rare Duchenne Muscular Dystrophy Mutation

February 25, 2021

The Code Breaker

The Code Breaker: Jennifer Doudna, Gene Editing, and the Future of the Human Race is a non-fiction book authored by American historian and journalist Walter Isaacson. Published in March 2021 by Simon & Schuster, it is a biography of Jennifer Doudna, the winner of the 2020 Nobel Prize in Chemistry for her work on the CRISPR system of gene editing.[1]

The book debuted at number one on The New York Times nonfiction best-seller list for the week ending March 13, 2021.[2]

Software Modules on the Terra Cluster

CAN

The Sword in the Stone

The Fisher King is a 1991 American comedy-drama film written by Richard LaGravenese and directed by Terry Gilliam. Starring Robin Williams and Jeff Bridges, with Mercedes Ruehl, Amanda Plummer, and Michael Jeter in supporting roles, the film tells the story of a radio shock jock who tries to find redemption by helping a man whose life he inadvertently shattered. It explores "the intermingling of New York City’s usually strictly separated social strata"[2] and has been described as "a modern day Grail Quest that fused New York romantic comedy with timeless fantasy".[3] The film was released in the United States by TriStar Pictures on September 20, 1991, and grossed $42 million on a $24 million budget.

Uther Pendragon

Uther Pendragon (/ˈjθər pɛnˈdræɡən, ˈθər/;[1] Welsh: Uthyr Pendragon, Uthyr Bendragon), also known as King Uther, is a legendary king of sub-Roman Britain and the father of King Arthur. A few minor references to Uther appear in Old Welsh poems, but his biography was first written down by Geoffrey of Monmouth in his Historia Regum Britanniae (History of the Kings of Britain), and Geoffrey's account of the character was used in most later versions. He is a fairly ambiguous individual throughout the literature, but is described as a strong king and a defender of his people. 
 
(Hero's Journey Hindu version of Sword in the Stone)
 
Shiva Dhanush (Sanskrit: शिव धनुष) or Pinaka (Sanskrit: पिनाक, pínāka) is the bow of Lord Shiva.

Background

Vijaya is the trident of Shiva used for total destruction or "Pralaya".

Legend

As per original Valmiki Ramayana [contested: no reference of this narration located in valmiki ramayan], two bows were created by God Devendra of equal capacity which were given to Rudra and Vishnu and requested them to fight with each other to know who is the powerful one. However just before the start of the war an Aakashvani said that the war will lead to total destruction and hence the war was stopped. On hearing Aakashvani, Rudra threw his Dhanush which fell on earth to be later known as "Shiva dhanush". It was later found by King Devaratha, the ancestor of King Janaka. It is mentioned in the Hindu epic Ramayana, when its hero Rama (another avatar of Vishnu) breaks it to marry Janaka's daughter as his wife.

Vishwakarma crafted two divine bows. He gave Sharanga to Lord Vishnu and Pinaka to Lord Shiva. King Janaka of Mithila had a daughter named Sita. In earlier part of her life, Sita while playing with her sisters had unknowingly lifted the table over which the bow had been placed; which was something no one in the kingdom could do. This incident was however observed by Janaka and he decided to make this incident as the backdrop for Sita's swayamvara.

Later, Janaka had announced that whosoever wanted to marry Sita had to lift the divine bow and string it. The bow was broken by Ayodhya's prince Rama when he attempted to string the bow, during the swayamvara of Sita, thereby winning the princess's hand in marriage. After the marriage when his father Dasharatha was returning to Ayodhya with Rama, Parashurama obstructed their path and challenged Rama for breaking his guru Shiva's bow. Rama extolled the sage. After that Dasharatha prayed to the sage to forgive him but Parashurama remained enraged and brought out Vishnu's bow. He then asked Rama to string the bow and fight a duel with him. Rama snatches the bow of Vishnu, strings it, places an arrow and points it straight at the challenger's heart. Rama then asks Parashurama what he will give as a target to the arrow. At this point, Parashurama feels himself devoid of his mystical energy. He realizes that Rama is the avatar of Vishnu.


One day, Rama was with his dear brother Lakshmana and his guru Viswamitra, when they all wandered into Mithila, the kingdom of King Janaka.  Sita was King Janaka’s only daughter who was to be wed to the man who could bend Shiva’s bow.  Many strong warriors came to attempt to bend Shiva’s bow, but no one succeeded of course! Rama easily took the bow and did not only bend it, but snapped it into many pieces

Fisher King

In Arthurian legend, the Fisher King (French: Roi pêcheur, Welsh: Brenin Pysgotwr), also known as the Wounded King or Maimed King (Roi blessé, in Old French Roi Méhaigié, Welsh: Brenin Clwyfedig), is the last in a long bloodline charged with keeping the Holy Grail. Versions of the original story vary widely, but he is always wounded in the legs or groin and incapable of standing. All he is able to do is fish in a small boat on the river near his castle, Corbenic, and wait for some noble who might be able to heal him by asking a certain question. In later versions, knights travel from many lands to try to heal the Fisher King, but only the chosen can accomplish the feat. This is achieved by Percival alone in the earlier stories; he is joined by Galahad and Bors in the later ones.  
 
Zeus, Indra and Thor

Similarities:
Zeus, the King of the Greek Gods can fairly be compared to Indra, the Rig-Vedic King of Hindu Gods. Both these deities had control over weather and had thunderbolts as their weapons. They both had kingly chariots. Like the dwelling place of Zeus and other Olympian Gods, Mount Olympus, the dwelling place of the Hindu Gods was in Swarga located high above in the sky on Mount Meru.
Thor was the God of thunder.
Baal was considered as god of Storm and had various weapons including the Thunder Bolt.
Dissimilarities:
Indra's reputation is the king of the Devas. He rides on a white elephant Iravata.
Zeus, the final and Supreme God of the Greek mythology. 
Thor was Son of Odin Chief God. He drove around clouds by a chariot driven by two Goats. Thor's weapon was a hammer Mjolnir which produced lightning and thunder.
Odin, the supreme Norse God went around on a eight legged horse.

See also

Chogyal

The Chogyal ("Dharma Kings", Tibetan: ཆོས་རྒྱལ, Wylie: chos rgyal, Sanskrit: धर्मराज) were the monarchs of the former kingdoms of Sikkim and Ladakh in present-day India, which were ruled by separate branches of the Namgyal dynasty. The Chogyal was the absolute monarch of Sikkim from 1642 to 1975, when the monarchy was abolished and its people voted in a referendum to make Sikkim the 22nd state of India.[1][2]

Live by the sword, die by the sword

Competent man

Specialization is for insects. The competent man, more often than not, is written without explaining how he achieved his wide range of skills and abilities. When such characters are young, there is often not much explanation as to how they acquired so many skills at an early age.
In computer programming jargon, a heisenbug is a software bug that seems to disappear or alter its behavior when one attempts to study it.
 
Statistical Assertions for Validating Patterns and
Finding Bugs in Quantum Programs

Yipeng Huang, Margaret Martonosi 
Princeton University

In electronics and telecommunications, jitter is the deviation from true periodicity of a presumably periodic signal, often in relation to a reference clock signal. In clock recovery applications it is called timing jitter.

https://sspinnovations.com/sectionpage/people/

Thank you for dancing from From Texas with a leap of Fath Quantum Biology contest

 
"Plank" is the term often given to the components of the political platform – the opinions and viewpoints about individual topics, as held by a party, person, or organization.

Gabriel's Horn: or Torricelli's trumpet: A simple object with finite volume but infinite surface area. Also, the Mandelbrot set and various other fractals are covered by a finite area, but have an infinite perimeter (in fact, there are no two distinct points on the boundary of the Mandelbrot set that can be reached from one another by moving a finite distance along that boundary, which also implies that in a sense you go no further if you walk "the wrong way" around the set to reach a nearby point).

gravitons may create observable “noise” in gravitational wave detectors such as LIGO, the Laser Interferometer Gravitational-Wave Observatory. “We’ve found that the quantum fuzziness of space-time is imprinted on matter as a kind of jitter,” said Maulik Parikh, a cosmologist at Arizona State University and a co-author of one of the papers.

In electronics and telecommunications, jitter is the deviation from true periodicity of a presumably periodic signal, often in relation to a reference clock signal. In clock recovery applications it is called timing jitter.

the jitter bug dance for
https://www.forkliftdanceworks.org/
Bohr bug: /bohr buhg/, n.

[from quantum physics] A repeatable bug; one that manifests reliably under a possibly unknown but well-defined set of conditions. Antonym of heisenbug; see also mandelbug, schroedinbug.

Steve Martin as the
In physics, jerk or jolt is the rate of change of acceleration; that is, the time derivative of acceleration, or the second derivative of velocity, or the third derivative of position. The SI unit for jerk is m/s3. Jerk can also be expressed in standard gravity per second (g/s). Jerk is a vector (directional) quantity.

Jerk (physics), "idiot physicists", Color Charge:

Color charge

Color charge is a property of quarks and gluons that is related to the particles' strong interactions in the theory of quantum chromodynamics (QCD).

The "color charge" of quarks and gluons is completely unrelated to the everyday meaning of color. The term color and the labels red, green, and blue became popular simply because of the loose analogy to the primary colors. Richard Feynman referred to his colleagues as "idiot physicists" for choosing the confusing name.

Idiot physicist colorful charecters
 
In mathematics, the four color theorem, or the four color map theorem, states that, given any separation of a plane into contiguous regions, producing a figure called a map, no more than four colors are required to color the regions of the map so that no two adjacent regions have the same color

In quantum chromodynamics (QCD), color confinement, often simply called confinement, is the phenomenon that color charged particles (such as quarks and gluons) cannot be isolated, and therefore cannot be directly observed in normal conditions below the Hagedorn temperature of approximately 2 trillion kelvin (corresponding to energies of approximately 130–140 MeV per particle).[1][2] Quarks and gluons must clump together to form hadrons. The two main types of hadron are the mesons (one quark, one antiquark) and the baryons (three quarks). In addition, colorless glueballs formed only of gluons are also consistent with confinement, though difficult to identify experimentally. Quarks and gluons cannot be separated from their parent hadron without producing new hadrons.

quantum jump from Frog Texas for Liberty Lunch, hold the octonions

How the Bits of Quantum Gravity Can Buzz

A Horn clause is a clause (a disjunction of literals) with at most one positive, i.e. unnegated, literal. Conversely, a disjunction of literals with at most one negated literal is called a dual-Horn clause.

Pharisee and the Publican

I am on a mission to cure Muscular Dystrophy and propose making this a political platform plank:

"Plank" is the term often given to the components of the political platform – the opinions and viewpoints about individual topics, as held by a party, person, or organization.

A scalar or scalar quantity in physics is a physical quantity that can be described by a single element of a number field such as a real number, often accompanied by units of measurement. A scalar is usually said to be a physical quantity that only has magnitude, possibly a sign, and no other characteristics

Scale invariance

In it's Scalar form Coulomb's law is identical to Newton's law of Gravity:

Coulomb's law

Newton's law of universal gravitation

  Electric field

 Perlin noise

Fractal structure in the scalar λ(φ21)2 theory

Fracton

condensed matter physics

The ‘Weirdest’ Matter, Made of Partial Particles, Defies Description

Theorists are in a frenzy over “fractons,” bizarre, but potentially useful, hypothetical particles that can only move in combination with one another.

Bistatic radar

Angular momentum coupling

John Clive Ward    "Ward Identity"

Quantum field theory

Quantum entanglement

Entanglement distillation

entangler (Java Script)

Oploggery

Separable state

Topological quantum field theory

The Russell Saunders Coupling Scheme

Coupling of Angular Momentum and Spectroscopic Term Symbols

Fracton-Elasticity Duality

Michael Pretko and Leo Radzihovsky

Haah codes on general three manifolds

Kevin T. Tian, Eric Samperton, Zhenghan Wang

Fracton (subdimensional particle)

Russell-Saunders or L-S Coupling  

The Russell Saunders Coupling Scheme 

Term symbol

Ultrafast control of fractional orbital angular momentum of microlaser emissions

Vortices as fractons
Darshil Doshi 1 & Andrey Gromov 

Vortex 

Toroid

Quaternionic Hopf fibrations

Excited state

Spin glass

In condensed matter physics, a spin glass is a model of a certain type of magnet.

Spin ice

A spin ice is a magnetic substance that does not have a single minimal-energy state. It has magnetic moments (i.e. "spin") as elementary degrees of freedom which are subject to frustrated interactions.

Gravitational field

In particle physics, a gauge boson is a force carrier, a bosonic particle that carries any of the fundamental interactions of nature, commonly called forces.
 

Sensor node

Chitosan

Chitin nanofibers are extracted from crustacean waste and mushrooms for possible development of products in tissue engineering, medicine, and industry.

Chitin

You got to be Chitin me! 

Sensor node Improvements on the protein–dipole Langevin–dipole model

Y.W. Xu, C.X. Wang, Y.Y. Shi 

QM/MM

Pauli matrices

Gell-Mann matrices

Exploring chemical space: Can AI take us where no human has gone before?

Del

Landauer Theory, Inelastic Scattering and Electron Transport in Molecular Wires

Partition and cluster talks:

Partition function (statistical mechanics)

Solvent model

In computational chemistry, a solvent model is a computational method that accounts for the behavior of solvated condensed phases.

Immunofluorescence

Reaction Path

Reaction coordinate

Following the Intrinsic Reaction Coordinate

Transition state

How Bell’s Theorem Proved ‘Spooky Action at a Distance’ Is Real

For

System partition and boot partition

as for

Hard drive cluster
Clusters are used to store files and data on the hard drive. The size of the cluster is important because space can be wasted on systems that are inefficient in sizing the clusters. ... Using a more efficient file system, such as FAT32 or NTFS, will save hard drive space because the file system uses a smaller cluster size

Data cluster

tiny problems to consider
Free Energy Calculations in Action: Theory, Applications and Challenges of Solvation Free

Z

Molecular Hamiltonian

Hamiltonian Monte Carlo

Hamiltonian vector field

Hamiltonian field theory

Gauge theory

RNAstructure: software for RNA secondary structure prediction and analysis

The RNAfold web server will predict secondary structures of single stranded RNA or DNA sequences. Current limits are 7,500 nt for partition function calculations and 10,000 nt for minimum free energy only predicitions.

An analyte, component (in clinical chemistry), or chemical species is a substance or chemical constituent that is of interest in an analytical procedure.

Magnetic immunoassay (MIA) is a novel type of diagnostic immunoassay using magnetic beads as labels in lieu of conventional enzymes (ELISA), radioisotopes (RIA) or fluorescent moieties (fluorescent immunoassays) to detect a specified analyte.

Bio-MEMS is an abbreviation for biomedical (or biological) microelectromechanical systems. Bio-MEMS have considerable overlap, and is sometimes considered synonymous, with lab-on-a-chip (LOC) and micro total analysis systems (μTAS). Bio-MEMS is typically more focused on mechanical parts and microfabrication technologies made suitable for biological applications. On the other hand, lab-on-a-chip is concerned with miniaturization and integration of laboratory processes and experiments into single (often microfluidic) chips. In this definition, lab-on-a-chip devices do not strictly have biological applications, although most do or are amenable to be adapted for biological purposes. Similarly, micro total analysis systems may not have biological applications in mind, and are usually dedicated to chemical analysis. A broad definition for bio-MEMS can be used to refer to the science and technology of operating at the microscale for biological and biomedical applications, which may or may not include any electronic or mechanical functions.[2] The interdisciplinary nature of bio-MEMS combines material sciences, clinical sciences, medicine, surgery, electrical engineering, mechanical engineering, optical engineering, chemical engineering, and biomedical engineering.[2] Some of its major applications include genomics, proteomics, molecular diagnostics, point-of-care diagnostics, tissue engineering, single cell analysis and implantable microdevices.

Cyclic enzyme system

A cyclic enzyme system is a theoretical system of two enzymes sharing a single substrate or cofactor, also referred to as a biochemical switching device.[1] It has been used as a biochemical implementation of a simple computational device, acting as a chemical diode.[2]

See also

Computational gene

Computational genes: a tool for molecular diagnosis and therapy of aberrant mutational phenotype

Israel M Martínez-Pérez,corresponding author1 Gong Zhang,2 Zoya Ignatova,2 and Karl-Heinz Zimmermann1

Computational Approaches to Biochemical Reactivity

Author: Nâaray-Szabâo, Gâabor, Warshel, Arieh
Date: 2002
Ch.4
"This Method partitions the enzyme into a quantum mechanical region and a larger molecular mechanical region (Warshel and Levitt 1976; Bash et al. 1991)"
so I suggest
PAM Partitioning Around Medoids and PAM Protospacer Adjacent Motif with Pax Genes:

Methyltransferase

DNA methyltransferase

Thrombin

Potential energy surface

Empirical distribution function

Free energy perturbation

Chemical kinetics

Enzyme catalysis

Web-based design and analysis tools for CRISPR base editing

COL4A6 collagen type IV alpha 6 chain [ Homo sapiens (human) ]

molecular biology

DNA Has Four Bases. Some Viruses Swap in a Fifth.

The DNA of some viruses doesn’t use the same four nucleotide bases found in all other life. New work shows how this exception is possible and hints that it could be more common than we think. 

Home base, first base, second base, third base... sort of like the all American game of baseball.

Pathophysiological Mechanisms of Sarcopenia in Aging and in Muscular Dystrophy

Exercise Mimetics: Impact on Health and Performance

 Weiwei Fan1and Ronald M. Evans

Kermit the frog hops to cure muscular dystrophy

Mandukasana

Stretching and hoping like a frog with Kermit the Frog is a

Film treatment

Frog, Texas

Frog is an unincorporated community in Kaufman County, located in the U.S. state of Texas.

Electroporation

Electroporation, or electropermeabilization, is a microbiology technique in which an electrical field is applied to cells in order to increase the permeability of the cell membrane, allowing chemicals, drugs, or DNA to be introduced into the cell (also called electrotransfer).[2][3] In microbiology, the process of electroporation is often used to transform bacteria, yeast, or plant protoplasts by introducing new coding DNA. If bacteria and plasmids are mixed together, the plasmids can be transferred into the bacteria after electroporation, though depending on what is being transferred cell-penetrating peptides or CellSqueeze could also be used. Electroporation works by passing thousands of volts (~8 kV/cm) across suspended cells in an electroporation cuvette.[2] Afterwards, the cells have to be handled carefully until they have had a chance to divide, producing new cells that contain reproduced plasmids. This process is approximately ten times more effective than chemical transformation.[4]

Electroporation is also highly efficient for the introduction of foreign genes into tissue culture cells, especially mammalian cells. For example, it is used in the process of producing knockout mice, as well as in tumor treatment, gene therapy, and cell-based therapy. The process of introducing foreign DNA into eukaryotic cells is known as transfection. Electroporation is highly effective for transfecting cells in suspension using electroporation cuvettes. Electroporation has proven efficient for use on tissues in vivo, for in utero applications as well as in ovo transfection. Adherent cells can also be transfected using electroporation, providing researchers with an alternative to trypsinizing their cells prior to transfection. One downside to electroporation, however, is that after the process the gene expression of over 7,000 genes can be affected.[5] This can cause problems in studies where gene expression has to be controlled to ensure accurate and precise results.

Although bulk electroporation has many benefits over physical delivery methods such as microinjections and gene guns, it still has limitations including low cell viability. Miniaturization of electroporation has been studied leading to microelectroporation and nanotransfection of tissue utilizing electroporation based techniques via nanochannels to minimally invasively deliver cargo to the cells.[6]

Electroporation has also been used as a mechanism to trigger cell fusion. Artificially induced cell fusion can be used to investigate and treat different diseases, like diabetes,[7][8][9] regenerate axons of the central nerve system,[10] and produce cells with desired properties, such as in cell vaccines for cancer immunotherapy.[11] However, the first and most known application of cell fusion is production of monoclonal antibodies in hybridoma technology, where hybrid cell lines (hybridomas) are formed by fusing specific antibody-producing B lymphocytes with a myeloma (B lymphocyte cancer) cell line.[12]

ElectroPen: An ultralow-cost piezoelectric electroporator
Gaurav Byagathvalli,1 Soham Sinha,2 Yan Zhang,2 Mark P. Styczynski,2 Janet Standeven,1 and M. Saad Bhamla2,
1Lambert High School, 805 Nichols Rd, Suwanee, GA, 30024, USA2School of Chemical & Biomolecular Engineering,
Georgia Institute of Technology, 311 Ferst Drive NW, Altanta, GA 30332, USA
(Dated: December 21, 2018)
 

Monty Python's Flying Circus

Electrophoresis

Electrophoresis is a laboratory technique used to separate DNA, RNA, or protein molecules based on their size and electrical charge. An electric current is used to move molecules to be separated through a gel. Pores in the gel work like a sieve, allowing smaller molecules to move faster than larger molecules. The conditions used during electrophoresis can be adjusted to separate molecules in a desired size range. 

Synchronous Serial Interface (SSI)
 

JSON (JavaScript Object Notation) is a lightweight data-interchange format. It is easy for humans to read and write. It is easy for machines to parse and generate.

Arduino is an open-source hardware and software company, project and user community that designs and manufactures single-board microcontrollers and microcontroller kits for building digital devices.

Asynchronous Communication Is The Future Of Work

Ramsey states in his landmark papers [3,4] of 1950: “In measurements of nuclear magnetic moments, a correction must be made for the magnetic field arising from the motions of the molecular electrons which are induced by the externally applied field.” Ramsey realized that corrections using only Lamb’s diamagnetic theory were inadequate for molecules, because in molecules there are additional shielding contributions arising from the second order paramagnetism. To address this problem he developed the necessary theoretical framework to explain and eventually to calculate the “chemical effect”, which would become the chemical shift commonly used now for structural elucidation. The calculation of the second order paramagnetic contribution to the shielding using perturbation theory has been a challenge to theoreticians for more than fifty years. The progress in this field is reported annually by Jameson and de Dios in the Annual Reviews in NMR Spectroscopy Series [5]. 
 
minimum cost circulation problem, Piezoresistive effect, a change in the electrical resistance of a material in response to mechanical stress Piezoelectricity, electrical charge built up in response to mechanical stress Piezoelectric sensor, a device that converts differences in physical force to generate voltage PIEZO1, a mechanosensitive ion protein

Plant PIEZO homologs modulate vacuole morphology during tip growth

Piezo sensors in animal cells are localized in the cell membrane and transduce mechanical signals... In animals, PIEZOs are plasma membrane–localized cation channels involved in diverse mechanosensory processes. We investigated PIEZO function in tip-growing cells...

Genome editing meets marsupials

Researchers at the RIKEN Center for Biosystems Dynamics Research (BDR) have succeeded in creating the first genetically engineered marsupial. This study, published in the scientific journal Current Biology, will contribute to deciphering the genetic background of unique characteristics observed only in marsupials.

Kiyonari explains, “was using a piezoelectronic element along with the needle, which allowed the needle to penetrate the hard shell coat and thick layer surrounding the egg. The piezo has thus made it possible to inject zygotes without significant damage.” 
 
quantum memories and  symmetry breaking,

Time crystal

quantum computing

Eternal Change for No Energy: A Time Crystal Finally Made Real

Like a perpetual motion machine, a time crystal forever cycles between states without consuming energy. Physicists claim to have built this new phase of matter inside a quantum computer.
PostgreSQL is a powerful, open source object-relational database system with over 30 years of active development that has earned it a strong reputation for reliability, feature robustness, and performance.

The NASA Glenn Research Center in Cleveland, Ohio

Tribology

Tribotronics is an area of research that combines machine elements and electronic components to create active tribological systems

Energy harvesting (also known as power harvesting or energy scavenging or ambient power) is the process by which energy is derived from external sources (e.g., solar power, thermal energy, wind energy, salinity gradients, and kinetic energy, also known as ambient energy), captured, and stored for small, wireless autonomous devices, like those used in wearable electronics and wireless sensor networks.

Goldberg polyhedron

See also

Transition state theory

Enzymatic reactions

Synchronicity is a concept, first introduced by analytical psychologist Carl Jung, which holds that events are "meaningful coincidences" if they occur with no causal relationship yet seem to be meaningfully related. During his career, Jung furnished several different definitions of it.

The esteemed psychologist William James says, “If there are supernormal powers, it is through the cracked and fragmented self that they enter."

Cortex-M4

The Arm Cortex-M4 processor is Arm’s high performance embedded processor. 

Tribology

Tribotronics is an area of research that combines machine elements and electronic components to create active tribological systems

Piezotronics effect is using the piezoelectric potential (piezopotential) created in materials with piezoelectricity as a “gate” voltage to tune/control the charge

Electronic textiles, also known as smart garments, smart clothing, smart textiles, or smart fabrics

A trion is a localized excitation which consists of three charged quasiparticles. A negative trion consists of two electrons and one hole and a positive trion consists of two holes and one electron. The trion itself is a quasiparticle and is somewhat similar to an exciton, which is a complex of one electron and one hole. The trion has a ground singlet state (spin s = 1/2) and an excited triplet state (s = 3/2). Here singlet and triplet degeneracies originate not from the whole system but from the two identical particles in it. The half-integer spin value distinguishes trions from excitons in many phenomena; for example, energy states of trions, but not excitons, are split in an applied magnetic field. Trion states were predicted theoretically and then observed experimentally in various optically excited semiconductors, especially in quantum dots and quantum well structures. There are experimental proofs of their existence in nanotubes supported by theoretical studies. Despite numerous reports of experimental trion observations in different semiconductor heterostructures, there are serious concerns on the exact physical nature of the detected complexes. The originally foreseen 'true' trion particle has a delocalized wavefunction (at least at the scales of several Bohr radii) while recent studies reveal significant binding from charged impurities in real semiconductor quantum wells.

Trions have been observed in atomically thin two-dimensional (2D) transition-metal dichalcogenide semiconductors. In 2D materials the form of the interaction between charge carriers is modified by the nonlocal screening provided by the atoms in the layer. The interaction is approximately logarithmic at short range and of Coulomb 1/r form at long range. The diffusion Monte Carlo method has been used to obtain numerically exact results for the binding energies of trions in 2D semiconductors within the effective mass approximation.

Wisdom of Solomon Chapter 13 Playing with Pyroelectricity Fermi Surface lattice dynamics doping nanopore semiconductors

 By David Vincent Bell Hirsch

Accepted 15thAugust 2014
DOI: 10.1039/b000000x
Abstract:In this work, we intend to calculate spin conduction matrixes of T-shaped spin circuits' branches. Also we investigate simultaneously effects of gold nano-channel length and cross section area variations on its non-zero elements. Our findings show that G11and G22 elements of series branches increase with simultaneously channel length reduction and channel cross section area grow up. For spin flip branches, G22element decreases with simultaneously nano-channel length and cross section area reduction. We choose copper metal as nano-channel because of its high conductance and lattice constant. 

Nanopore

A Graph is a set of points (called nodes or vertices), any two of which may or may not be connected by a line. (flow network graph theory for graphene)


In mathematics, graph theory is the study of graphs, which are mathematical structures used to model pairwise relations between objects. A graph in this context is made up of vertices (also called nodes or points) which are connected by edges (also called links or lines) In graph theory, a flow network (also known as a transportation network) is a directed graph where each edge has a capacity and each edge receives a flow. The amount of flow on an edge cannot exceed the capacity of the edge. Often in operations research, a directed graph is called a network, the vertices are called nodes and the edges are called arcs.

Max-flow min-cut theorem

Magnetic space group

Magnetic groups and time reversal

In addition to crystallographic space groups there are also magnetic space groups (also called two-color (black and white) crystallographic groups or Shubnikov groups). These symmetries contain an element known as time reversal. They treat time as an additional dimension, and the group elements can include time reversal as reflection in it. They are of importance in magnetic structures that contain ordered unpaired spins, i.e. ferro-, ferri- or antiferromagnetic structures as studied by neutron diffraction. The time reversal element flips a magnetic spin while leaving all other structure the same and it can be combined with a number of other symmetry elements. Including time reversal there are 1651 magnetic space groups in 3D (Kim 1999, p.428). It has also been possible to construct magnetic versions for other overall and lattice dimensions (Daniel Litvin's papers, (Litvin 2008), (Litvin 2005)).

Kurtis Lee Geerlings2013
Subliminal stimuliSubliminal perceptions, also known as subliminal messages, are messages, either visual or auditory, that are presented just beyond the threshold of human perception.
Irreducible mind :

 toward a psychology for the 21 st century I Edward F. Kelly

The Esalen Institute, commonly called Esalen, is a non-profit American retreat center and intentional community in Big Sur, California, which focuses on humanistic alternative education. The Institute played a key role in the Human Potential Movement beginning in the 1960s. Its innovative use of encounter groups, a focus on the mind-body connection, and their ongoing experimentation in personal awareness introduced many ideas that later became mainstream.

Parallel Circuits

An anode is an electrode through which the conventional current enters into a polarized electrical device. This contrasts with a cathode, an electrode through which conventional current leaves an electrical device. A common mnemonic is ACID for "anode current into device" The direction of conventional current (the flow of positive charges) in a circuit is opposite to the direction of electron flow, so (negatively charged) electrons flow out the anode into the outside circuit. In a galvanic cell, the anode is the electrode at which the oxidation reaction occurs.

Lithium–silicon electrodes are a lithium-ion battery technology that employ a silicon anode and lithium ions as the charge carriers. Silicon has a much larger energy density (25 times as many lithium ions) than graphite. Silicon's large volume change when lithium is inserted is the main obstacle to commercializing this device. Commercial battery anodes may have small amounts of silicon, boosting their performance slightly. The amounts are closely held trade secrets, limited as of 2018 to at most 10% of the anode.

A crystalline silicon anode has a theoretical specific capacity of 3600 mAh/g, approximately ten times that of anodes such as graphite (372 mAh/g). Each silicon atom can bind up to 3.75 lithium atoms in its fully lithiated state (Li 3.75Si), compared to one lithium atom per 6 carbon atoms for the fully lithiated graphite (LiC 6).

A cathode is the electrode from which a conventional current leaves a polarized electrical device. This definition can be recalled by using the mnemonic CCD for Cathode Current Departs. A conventional current describes the direction in which positive charges move. Electrons have a negative electrical charge, so the movement of electrons is opposite to that of the conventional current flow. Consequently, the mnemonic cathode current departs also means that electrons flow into the device's cathode from the external circuit. Cations. The negatively charged electrode in electrolysis is called the cathode . Positively charged ions are called cations . They move towards the cathode.
Lithium tantalate (LiTaO3) is a perovskite which possesses unique optical, piezoelectric and pyroelectric properties which make it valuable for nonlinear optics, passive infrared sensors such as motion detectors, terahertz generation and detection, surface acoustic wave applications, cell phones and possibly pyroelectric nuclear fusion. Considerable information is available from commercial sources about this salt. 

What you resist persists”

It was the renowned Swiss psychiatrist, Carl Jung (1875–1961), who taught us that whatever you resist persists. What he meant by that is the more you resist anything in life, the more you bring it to you.
Resistors are in parallel if their terminals are connected to the same two nodes. The equivalent overall resistance is smaller than the smallest parallel resistor. Written by Willy McAllister.

A multiferroic molecular magnetic qubit 


Charles Proteus Steinmetz

Mathematician, electrical engineer, philosopher, socialist and technological pioneer
(April 9, 1865, - October 26, 1923)
 
Charles Proteus Steinmetz (April 9, 1865 – October 26, 1923) was a German-born American mathematician and electrical engineer. He fostered the development of alternating current that made possible the expansion of the electric power industry in the United States, formulating mathematical theories for engineers. He made ground-breaking discoveries in the understanding of hysteresis that enabled engineers to design better electromagnetic apparatus equipment including especially electric motors for use in industry.

AC hysteresis theory
 
In crystallography, crystal structure is a description of the ordered arrangement of atoms, ions or molecules in a crystalline material.

In mathematics, a Casimir element (also known as a Casimir invariant or Casimir operator) is a distinguished element of the center of the universal enveloping algebra of a Lie algebra. A prototypical example is the squared angular momentum operator, which is a Casimir element of the three-dimensional rotation group.

Retrocognition (also known as postcognition), from the Latin retro meaning "backward, behind" and cognition meaning "knowing," describes "knowledge of a past event which could not have been learned or inferred by normal means." The term was coined by Frederic W. H. Myers.

Precognition (from the Latin prae-, "before" and cognitio, "acquiring knowledge"), also called prescience, future vision, future sight is a claimed psychic ability to see events in the future.

Borophene is a crystalline atomic monolayer of boron, i.e., it is a two-dimensional allotrope of boron and also known as boron sheet.
 
What is the meaning of neuroaesthetics?
 
Neuroaesthetics is the study of how aesthetic perception, production, judgment, appreciation, and emotional response are produced and experienced from a neurobiological basis.

Peak shift principle

This psychological phenomenon is typically known for its application in animal discrimination learning. In the peak shift effect, animals sometimes respond more strongly to exaggerated versions of the training stimuli. For instance, a rat is trained to discriminate a square from a rectangle by being rewarded for recognizing the rectangle. The rat will respond more frequently to the object for which it is being rewarded to the point that a rat will respond to a rectangle that is longer and more narrow with a higher frequency than the original with which it was trained. This is called a supernormal stimulus. The fact that the rat is responding more to a 'super' rectangle implies that it is learning a rule.

This effect can be applied to human pattern recognition and aesthetic preference. Some artists attempt to capture the very essence of something in order to evoke a direct emotional response. In other words, they try to make a 'super' rectangle to get the viewer to have an enhanced response. To capture the essence of something, an artist amplifies the differences of that object, or what makes it unique, to highlight the essential features and reduce redundant information. This process mimics what the visual areas of the brain have evolved to do and more powerfully activates the same neural mechanisms that were originally activated by the original object.

Definition of: asynchronous protocol
asynchronous protocol

Communication protocol

A communications protocol such as ASCII, TTY, Kermit and Xmodem, that transmits bits at a non-uniform rate. Contrast with synchronous protocol. See asynchronous transmission, ASCII protocol, TTY protocol, Kermit and Xmodem.

Kermit (protocol)

 Kermit hops to cure Muscular Dystrophy 

Step-by-step guide to making your first request to the new Twitter API v2

You Can Now Genetically Engineer Your Own Mutant Frogs For $499

A well-known biohacker wants to help you channel your inner geneticist.

KERMIT? IS THAT YOU?

New gene-editing kit puts the power of frog growth into citizen scientists' hands

by Helen Santoro

Josiah Zayner

A Biohacker Regrets Publicly Injecting Himself With CRISPR

“There’s no doubt in my mind that somebody is going to end up hurt eventually.”

Welcome to python-twitter’s documentation!

selenium-webdriver

Selenium is a browser automation library. Most often used for testing web-applications, Selenium may be used for any task that requires automating interaction with the browser.

You will need to download additional components to work with each of the major browsers. The drivers for Chrome, Firefox, and Microsoft's IE and Edge web browsers are all standalone executables that should be placed on your system PATH. Apple's safaridriver is shipped with Safari 10 for OS X El Capitan and macOS Sierra. You will need to enable Remote Automation in the Develop menu of Safari 10 before testing.

Browser Component
Chrome chromedriver(.exe)
Internet Explorer IEDriverServer.exe
Edge MicrosoftWebDriver.msi
Firefox geckodriver(.exe)
Safari safaridriver


TensorFlow makes it easy for beginners and experts to create machine learning models.

tensor fascia latae (muscles of the hip joint)

Get Hip with it.

Selenium is an antioxidant, helping to prevent free-radical damage. ... Research Note: Some research suggests selenium may help prevent rheumatoid arthritis (RA), but it has not been shown to relieve pain or stiffness in people with established disease.

Well, I went to


and then


In particle theory, the skyrmion (/ˈskɜːrmi.ɒn/) is a topologically stable field configuration of a certain class of non-linear sigma models. It was originally proposed as a model of the nucleon by Tony Skyrme in 1962. As a topological soliton in the pion field, it has the remarkable property of being able to model, with reasonable accuracy, multiple low-energy properties of the nucleon, simply by fixing the nucleon radius. It has since found application in solid state physics, as well as having ties to certain areas of string theory. 
Virtual Tissues (model of Polycystic Kidney Disease and vascular tumor growth), how using Python we were able to significantly increase access to Virtual Tissue models.

Quantum jump method

Psychophysics quantitatively investigates the relationship between physical stimuli and the sensations and perceptions they produce.

Physicists' finding could revolutionize information transmission

 Psychoneuroimmunology (PNI), also referred to as psychoendoneuroimmunology (PENI) or psychoneuroendocrinoimmunology (PNEI), is the study of the interaction between psychological processes and the nervous and immune systems of the human body.

Cell force sensing using thin elastomer films

 These hybrid schools of Psychophysics as well Psychoneuroimmunology have some considerations with Artificial Intelligent sensors for innovation applications.

E-textiles

Python Programming, Myocyte modeling of COL6A1 2 3 muscle tissue engineering on CpG islands

Linking phenotypes to genotypes: A newly devised gene-editing strategy

Exponential (myofibrils) growth

A myofibril (also known as a muscle fibril) is a basic rod-like unit of a muscle cell. Muscles are composed of tubular cells called myocytes, known as muscle fibers in striated muscle, and these cells in turn contain many chains of myofibrils.
Trion our smart garments, tribotronic smart clothing, smart spintronic textiles, or smart fabrics for frog men from Frog Texas with quantum leaps over the logarithm L'Hospital's Rule...

 In particle physics, a pion (or a pi meson, denoted with the Greek letter pi:
π
) is any of three subatomic particles:
π0
,
π+
, and
π
.

Skyrmions and Antiskyrmions in Quasi-Two-Dimensional Magnets

Each pion consists of a quark and an antiquark and is therefore a meson. Pions are the lightest mesons and, more generally, the lightest hadrons.

Natural language processing

Magnetic materials/data storage

One particular form of skyrmions is magnetic skyrmions, found in magnetic materials that exhibit spiral magnetism due to the Dzyaloshinskii-Moriya interaction, double-exchange mechanism or competing Heisenberg exchange interactions.

Interpretations of quantum mechanics

Photonic-crystal fiber (PCF) is a class of optical fiber based on the properties of photonic crystals. It was first explored in 1996 at University of Bath, UK.
The particle-in-cell (PIC) method refers to a technique used to solve a certain class of partial differential equations. In this method, individual particles (or fluid elements) in a Lagrangian frame are tracked in continuous phase space, whereas moments of the distribution such as densities and currents are computed simultaneously on Eulerian (stationary) mesh points.

Pluripotency

In cell biology, pluripotency (Lat. pluripotentia, "ability for many [things]") Induced pluripotent stem cells, commonly abbreviated as iPS cells or iPSCs, are a type of pluripotent stem cell artificially derived from a non-pluripotent cell, typically an adult somatic cell, by inducing a "forced" expression of certain genes and transcription factors

Induced pluripotent stem cell

 Paramagnetic compounds (and atoms) are attracted to magnetic fields while diamagnetic compounds (and atoms) are repelled from magnetic fields.

In crystallography, the terms crystal system, crystal family, and lattice system each refer to one of several classes of space groups, lattices, point groups, or crystals. In crystallography, the hexagonal crystal family is one of the 6 crystal families, which includes 2 crystal systems (hexagonal and trigonal) and 2 lattice systems (hexagonal and rhombohedral). The hexagonal lattice or triangular lattice is one of the five 2D lattice types.
A nanowire battery uses nanowires to increase the surface area of one or both of its electrodes. Some designs (silicon, germanium and transition metal oxides), variations of the lithium-ion battery have been announced, although none are commercially available. All of the concepts replace the traditional graphite anode and could improve battery performance.

Non-homologous end joining (NHEJ) is a pathway that repairs double-strand breaks in DNA

The Lennard-Jones potential (also termed the L-J potential, 6-12 potential, or 12-6 potential) is a mathematically simple model that approximates the interaction between a pair of neutral atoms or molecules. A form of this interatomic potential was first proposed in 1924 by John Lennard-Jones.

Sodium bisulfate

The Ogye is an extremely rare and old breed of Chickens, that has been found and raised in South Korea for centuries

Identification of DNA-Methylated CpG Islands Associated With Gene Silencing in the Adult Body Tissues of the Ogye Chicken Using RNA-Seq and Reduced Representation Bisulfite Sequencing

  • 1Genome Editing Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon, South Korea
  • 2Department of Bioinformatics, KRIBB School of Bioscience, University of Science and Technology, Daejeon, South Korea
 
Gene silencing is the regulation of gene expression in a cell to prevent the expression of a certain gene. Gene silencing can occur during either transcription or translation and is often used in research.
The intent of the python modeling is HDF5 Tensorflow to address COLA6 Trion innovations....

CpG islands, Maui, Myocyte models

Learn more about CpG Island

nucleosome positioning and
histone modification states
can be used to classify promoters
associated with different types of transcription initiation patterns

CpG sites

Myogenesis is the formation of muscular tissue... If placed in cell culture, most myoblasts will proliferate if enough fibroblast growth factor (FGF) or another growth factor is present in the medium surrounding the cells. When the growth factor runs out, the myoblasts cease division and undergo terminal differentiation into myotubes.

Gene drive

Selfish genetic element

The Molecular Modeling Toolkit

The Molecular Modelling Toolkit (MMTK) is an Open Source program library for molecular simulation applications. In addition to providing ready-to-use implementations of standard algorithms, MMTK serves as a code basis that can be easily extended and modified to deal with standard and non-standard problems in molecular simulations.

The three most common usage patterns of MMTK are:

  • Writing Python scripts that make use of MMTK functions for standard simulation and modelling applications. This is similar to using other simulation packages with a scripting language (i.e. CHARMM or Gromos), but with the added advantage of having access to lots of useful Python modules from elsewhere.

  • Writing modules that interact closely with MMTK (and perhaps other packages) to solve problems for which no standard solution exists. For example, adding a particular force field term or a particular simulation or analysis algorithm. There is not much competition for MMTK in that domain.

  • Writing application programs in Python that use MMTK internally, for users that do not need to know anything about such internals. Those programs can provide easy-to-use graphical interfaces (see e.g. DomainFinder and nMOLDYN) or be integrated into a Web service (see e.g. WEBnm@).

Langevin equation

Solutions of the Kramers Equation

Kramers Equation

Kramers' law

Kramers theorem

Grote–Hynes theory

Groot (Marvel Cinematic Universe)

Laplace transform

Protein dynamics, thermal stability, and free-energy landscapes: a molecular dynamics investigation

Outer sphere electron transfer

Genus (mathematics)

Non-orientable surfaces

Graph Hole

Einstein relation (kinetic theory)

Solvent model

Applications to QSAR and QSPR

The Born-Oppenheimer Approximation Simplifies the Schrödinger Equation for Molecules

The Self-Consistent Field and the Hartree-Fock Limit

Forming limit prediction using a self-consistent crystal plasticity framework: a case study for body-centered cubic materials

Anisotropy

Multi-configurational self-consistent field

List of quantum chemistry and solid-state physics software

List of software for nanostructures modeling

Diabatic

SCRF

Kirkwood-Onsager Model

Linear isotropic dielectrics

Self-Consistent Reaction Field

Electric displacement field

Isotropic Medium

Apparent surface charge models

Boundary element method

Tessellation

Two-dimensional tessellation by molecular tiles constructed from halogen–halogen and halogen–metal networks

Molecular Hamiltonian

Clamped nucleus Hamiltonian

Advanced and retarded Green's functions

The surface command creates and displaysmolecular surfaces, either atomically detailed solvent-excluded surfaces (default) or lower-resolution Gaussian surfaces.

MDAnalysis

A Python package for the handling and analysis of molecular simulations data.

The Molecular Modeling Toolkit (MMTK) is a open source Python library formolecular modeling and simulation with a focus on biomolecular systems, written in a mixture of Python and C. It provides standard techniques such as Molecular Dynamics or normal mode calculations in a ready-to-use form, but also provides a basis of low-level operations on top of which new techniques can easily be implemented.

Reaction Mechanism Generator

Curry–Howard correspondence

Hilbert-style deduction systems and combinatory logic

Peirce's law

Pierce oscillator

The philosophy of computer science is concerned with the philosophical questions that arise within the study of computer science. There is still no common understanding of the content, aim, focus, or topic of the philosophy of computer science,[1] despite some attempts to develop a philosophy of computer science like the philosophy of physics or the philosophy of mathematics. Due to the abstract nature of computer programs and the technological ambitions of computer science, many of the conceptual questions of the philosophy of computer science are also comparable to the philosophy of science, philosophy of mathematics, and the philosophy of technology.[2]

Random forest

Random forests or random decision forests

Preliminaries: decision tree learning

Logical intuition

Logical Intuition, or mathematical intuition or rational intuition, is a series of instinctive foresight, know-how and savviness often associated with the ability to perceive logical or mathematical truth—and the ability to solve mathematical challenges efficiently.[1][2] Humans apply logical intuition in proving mathematical theorems,[3] validating logical arguments,[4] developing algorithms and heuristics,[5] and in related contexts where mathematical challenges are involved.[6] The ability to recognize logical or mathematical truth and identify viable methods may vary from person to person, and may even be a result of knowledge and experience, which are subject to cultivation.[7] The ability may not be realizable in a computer program by means other than genetic programming or evolutionary programming.[8]

Monkey King Festival

The Monkey King Festival (Chinese: 齊天大聖千秋) is celebrated in Hong Kong on the 16th day of the eighth Lunar month of the Chinese calendar, corresponding to September according to the Common era calendar, a day after the Mid Autumn Festival. The origin of the festival is traced to the epic 16th century novel Journey to the West (Xiyou Ji, 西遊記) written by the Chinese novelist Wu Cheng'en (1500–1582) during the Ming Dynasty (1368–1644).[1][2] The novel brings out the concept of immortality from Taoism and rebirth from Buddhism.[3] The monkey Sun Wukong, a character in the novel, is the featured figure of the festival.[1]

Hanuman Jayanti is observed on the full moon day of the Shukla Paksha of the Hindu calendar month of Chaitra. Tuesdays and Saturdays are the main days to pray in front of Lord Hanuman,

Jayanti (Hinduism)

Shukla Paksha (Waxing Moon period) is a period of 15 days, which begins on the Shukla Amavasya (New Moon) day and culminating Purnima (Full Moon) day and is considered auspicious because it is favorable to growth or expansion on every plane of existence i.e. Mental, Physical and Spiritual Plane.

Just hang in there and let go

- Evolutionary Gorilla Guru AI Human Chimera Monkey Mind Mantra for Machine Learning in a Random Forest

Wildlife Tonight

Kruskal–Wallis one-way analysis of variance

Method

Raspberry Pi

Computer

Sunday
,
March 14
Pi Day 2021 in United States

Ātman (Hinduism)

Ātman (/ˈɑːtmən/; Sanskrit: आत्मन्) is a Sanskrit word that means inner self, spirit, or soul.[1][2] In Hindu philosophy, especially in the Vedanta school of Hinduism, Ātman is the first principle:[3] the true self of an individual beyond identification with phenomena, the essence of an individual. In order to attain Moksha (liberation), a human being must acquire self-knowledge (atma Gyan). For the different schools of thought, self-realization is that one's true self (Jīvātman) and the ultimate reality (Brahman) are: completely identical (Advaita, Non-Dualist),[2][4] completely different (Dvaita, Dualist), or simultaneously non-different and different (Bhedabheda, Non-Dualist + Dualist).[5]

The six orthodox schools of Hinduism believe that there is Ātman in every living being (jiva). This is a major point of difference with the Buddhist doctrine of Anatta, which holds that there is no soul or self.[6][7][8] 

Paksha

Apparent retrograde motion 

Green's function (many-body theory)

The signs of the Green functions have been chosen so that Fourier transform of the two-point () thermal Green function for a free particle is

and the retarded Green function is

where

is the Matsubara frequency.

Monkey mind

Happy birthday to you, happy birthday to you Monkey God, you smell like a divine Monkey God, and act like one too!

related to

Nine Emperor Gods Festival

The Nine Emperor Gods Festival (Malay: Perayaan Dewa Sembilan Maharaja, Thai: เทศกาลกินเจ) is a nine-day Taoist celebration beginning on the eve of the ninth lunar month of the Chinese calendar, nine-emperor-gods-festival-celebrated-with-primarily in Southeast Asian countries such as Malaysia, Singapore and Thailand by the Peranakans (exclude other Overseas Chinese community).

related to

Navaratri

And that could get an evolutionary ape thinking...
Well I would be an evolutionary great ape's uncle
Evolutionary decicions for Monkey God's birthday present.

Go bannan bonds! 

A recurrent COL6A1 pseudoexon insertion causes muscular dystrophy and is effectively targeted by splice-correction therapies


NCI PhaseIIB Bridge Award

Closing in on a cure for Duchenne muscular dystrophy

My name is David Vincent Bell Hirsch and perhaps performance art may assist with medical arts for curing muscular dystrophy. Thank you for development direction. I am encouraging native Americans and minorities

Minority Business Development Agency

with work of

Eric Olson, Ph.D.

Annie and Willie Nelson Professorship in Stem Cell Research; Pogue Distinguished Chair in Research on Cardiac Birth Defects; The Robert A. Welch Distinguished Chair in Science

David J. Hardy

Contact Information

Girls rarely develop DMD because they have two dystrophin genes, whereas boys have just one. A girl's healthy gene tends to override her mutated one, causing mild if any symptoms.

Causes/Inheritance

Who carries the gene for muscular dystrophy?

Inheriting muscular dystrophy. You have two copies of every gene (with the exception of the sex chromosomes). You inherit a copy from one parent, and the other copy from the other parent. If one or both of your parents has a mutated gene that causes MD, it can be passed on to you.

Partitioning Around Medoids (PAM)

PAM Partitioning Around Medoids and PAM Protospacer Adjacent Motif with Pax Genes:

 

Pax genes

Protospacer adjacent motif

A protospacer adjacent motif (PAM) is a 2–6-base pair DNA sequence immediately following the DNA sequence targeted by the Cas9 nuclease in the CRISPR bacterial adaptive immune system.

I Ching & Insights into

By Katya Walter

Katya has written books on this subject matter:

Tao of Chaos: Merging East and West

Book by Katya Walter

 

Muscular Dystrophy Information Page

CRISPR/Cpf1

Pax3/Pax7 mark a novel population of primitive myogenic cells during development

Human skeletal muscle organoids model fetal myogenesis and sustain uncommitted PAX7 myogenic progenitors 

Election of King Wamba, Wamba, King of the Visigoths c. 643 – 687/688
Oil on canvas by Francisco de Paula Van Halen (1843)

Wamba (king)

Flavius Paulus

Propaganda in Augustan Rome

Imperial Propaganda

A Reassessment of Visigothic Jewish Policy, 589–711

Mob rule or ochlocracy (Greek: ὀχλοκρατία, romanized: okhlokratía; Latin: ochlocratia) is the rule of government by a mob or mass of people

Propaganda in Fascist Italy

What did the wampum represent?

He endorsed wampum was a symbol of peace. The term wampum means shells. The beads are made from a round clam shell known as the Quahog. Wampum beads are strung and woven together to form wampum belts.
Samiri or the Samiri (Arabic: السامري‎, romanizedas-Sāmirī) is a phrase used by the Quran to refer to a rebellious follower of Moses who created the golden calf and attempted to lead the Hebrews into idolatry. According to the twentieth chapter of the Quran, Samiri created the calf while Moses was away for 40 days on Mount Sinai, receiving the Ten Commandments.[1] In contrast to the account given in the Hebrew Bible, the Quran does not blame Aaron for the calf’s creation. 

Sabr

Propaganda through media

Ethical, Legal and Social Aspects research

The acronyms ELSI (in the United States) and ELSA (in Europe) refer to research activities that anticipate and address ethical, legal and social implications (ELSI) or aspects (ELSA) of emerging sciences, notably genomics and nanotechnology.


The next deadline is Sept. 5th, 2021.


UT
Deep Learning
and

Deep Reinforcement Learning

In the philosophy of thermal and statistical physics, the Brownian ratchet or Feynman–Smoluchowski ratchet is an apparent perpetual motion machine first analysed in 1912 as a thought experiment by Polish physicist Marian Smoluchowski.[1] It was popularised by American Nobel laureate physicist Richard Feynman in a physics lecture at the California Institute of Technology on May 11, 1962, during his Messenger Lectures series The Character of Physical Law in Cornell University in 1964 and in his text The Feynman Lectures on Physics[2] as an illustration of the laws of thermodynamics. The simple machine, consisting of a tiny paddle wheel and a ratchet, appears to be an example of a Maxwell's demon, able to extract useful work from random fluctuations (heat) in a system at thermal equilibrium in violation of the second law of thermodynamics. Detailed analysis by Feynman and others showed why it cannot actually do this.

Kinesin, an example of a molecular motor that uses ATP to "walk" along nanotubules, is now thought to be an example of a Brownian motor.

 
Dreidel driven scientific research!

Brownian motor

In more recent times, humans have attempted to apply this knowledge of natural Brownian motors to solve human problems. The applications of Brownian motors are most obvious in nanorobotics due to its inherent reliance on directed motion. 

Muller's ratchet

Genetic hitchhiking

Experimental realization of Feynman's ratchet

Jaehoon Bang8,1, Rui Pan8,2

, Thai M Hoang9,3, Jonghoon Ahn1, Christopher Jarzynski4

Feynman's lectures

Ratchet and pawl

Bohm diffusion

The diffusion of plasma across a magnetic field was conjectured to follow the Bohm diffusion scaling as indicated from the early plasma experiments of very lossy machines. This predicted that the rate of diffusion was linear with temperature and inversely linear with the strength of the confining magnetic field.  (see CodingtheMatrix Lossy compression notes, much further in this research article)

Collective identity Fusion in The difficult art of giving space(time) when you love someone (with a drude particle on their shoulder)

By David Vincent Bell Hirsch
Lorenzo's Oil is a 1992 American drama film directed by George Miller. It is based on the true story of Augusto and Michaela Odone, two parents in a relentless search for a cure for their son Lorenzo's adrenoleukodystrophy (ALD). It was filmed primarily from September 1991 to February 1992 in Pittsburgh, Pennsylvania.[1] The film had a limited release in North America on December 30, 1992, with a nationwide release two weeks later on January 15, 1993. It was generally well received by the critics and received two nominations at the 65th Academy Awards but was a box office bomb, grossing only $7.2 million against its $30 million budget.

Medicalisation is associated with a social process that Illich termed 'iatrogenesis'. This concept refers to the detrimental consequences of medical interventions (clinical iatrogenesis), such as adverse drug reactions and hospital acquired infections.

A hot-cold empathy gap is a cognitive bias in which people underestimate the influences of visceral drives on their own attitudes, preferences, and behaviors.[1]

The most important aspect of this idea is that human understanding is "state-dependent". For example, when one is angry, it is difficult to understand what it is like for one to be calm, and vice versa; when one is blindly in love with someone, it is difficult to understand what it is like for one not to be, (or to imagine the possibility of not being blindly in love in the future). Importantly, an inability to minimize one's gap in empathy can lead to negative outcomes in medical settings (e.g., when a doctor needs to accurately diagnose the physical pain of a patient),[2] and in workplace settings (e.g., when an employer needs to assess the need for an employee's bereavement leave).[3]

Hot-cold empathy gaps can be analyzed according to their direction:[2]

  1. Hot-to-cold: People under the influence of visceral factors (hot state) don't fully grasp how much their behavior and preferences are being driven by their current state; they think instead that these short-term goals reflect their general and long-term preferences.
  2. Cold-to-hot: People in a cold state have difficulty picturing themselves in hot states, minimizing the motivational strength of visceral impulses. This leads to unpreparedness when visceral forces inevitably arise.

They can also be classified in regards to their relation with time (past or future) and whether they occur intra- or inter-personally:[2]

  1. intrapersonal prospective: the inability to effectively predict their own future behavior when in a different state. See also projection bias.[4]
  2. intrapersonal retrospective: when people recall or try to understand behaviors that happened in a different state. See retrospective hot-cold empathy gaps.
  3. interpersonal: the attempt to evaluate behaviors or preferences of another person who is in a state different from one's own.

The term hot-cold empathy gap was coined by Carnegie Mellon University psychologist, George Loewenstein. Hot-cold empathy gaps are one of Loewenstein's major contributions to behavioral economics.

Describe the competitive escalation paradigm and how it can be detrimental to financial decisions. Be sure to include in your discussion what competitive traps are and how to avoid them. Provide some examples of both competitive escalation and competitive traps. Your response must be a minimum of 300 words in length.

The Fisher–Yates shuffle is an algorithm for generating a random permutation of a finite sequence—in plain terms, the algorithm shuffles the sequence. The algorithm effectively puts all the elements into a hat; it continually determines the next element by randomly drawing an element from the hat until no elements remain. The algorithm produces an unbiased permutation: every permutation is equally likely. The modern version of the algorithm is efficient: it takes time proportional to the number of items being shuffled and shuffles them in place.

The Fisher–Yates shuffle is named after Ronald Fisher and Frank Yates, who first described it, and is also known as the Knuth shuffle after Donald Knuth. A variant of the Fisher–Yates shuffle, known as Sattolo's algorithm, may be used to generate random cyclic permutations of length n instead of random permutations

In mathematics, particularly in matrix theory, a permutation matrix is a square binary matrix that has exactly one entry of 1 in each row and each column and 0s elsewhere. Each such matrix, say P, represents a permutation of m elements and, when used to multiply another matrix, say A, results in permuting the rows (when pre-multiplying, to form PA) or columns (when post-multiplying, to form AP) of the matrix A.

Composition of permutations

The absence of good (Latin: privatio boni) is a theological doctrine that evil, unlike good, is insubstantial, so that thinking of it as an entity is misleading. Instead, evil is rather the absence or lack ("privation") of good.

A 'quadratic degree of freedom' is one for which the energy depends on the square of some property. Consider the kinetic and potential energies associated with translational, rotational and vibrational energy.

Octet rule

Nearest neighbor search (NNS), as a form of proximity search, is the optimization problem of finding the point in a given set that is closest (or most similar) to a given point. Closeness is typically expressed in terms of a dissimilarity function: the less similar the objects, the larger the function values. Formally, the nearest-neighbor (NN) search problem is defined as follows: given a set S of points in a space M and a query point q ∈ M, find the closest point in S to qDonald Knuth in vol. 3 of The Art of Computer Programming (1973) called it the post-office problem, referring to an application of assigning to a residence the nearest post office. A direct generalization of this problem is a k-NN search, where we need to find the k closest points.

Topological quantum computer

A topological quantum computer is a theoretical quantum computer that employs two-dimensional quasiparticles called anyons, whose world lines pass around one another to form braids in a three-dimensional spacetime (i.e., one temporal plus two spatial dimensions). These braids form the logic gates that make up the computer. The advantage of a quantum computer based on quantum braids over using trapped quantum particles is that the former is much more stable. Small, cumulative perturbations can cause quantum states to decohere and introduce errors in the computation, but such small perturbations do not change the braids' topological properties. This is like the effort required to cut a string and reattach the ends to form a different braid, as opposed to a ball (representing an ordinary quantum particle in four-dimensional spacetime) bumping into a wall. Alexei Kitaev proposed topological quantum computation in 1997. While the elements of a topological quantum computer originate in a purely mathematical realm, experiments in fractional quantum Hall systems indicate these elements may be created in the real world using semiconductors made of gallium arsenide at a temperature of near absolute zero and subjected to strong magnetic fields.

"Fishers of men" is a phrase used in the gospels to describe the mandate given by Jesus to his first disciples. Two brother fishermen, Simon called Peter and Andrew, were casting a net into the Sea of Galilee

The Fisher information is used in machine learning techniques such as elastic weight consolidation,[22] which reduces catastrophic forgetting in artificial neural networks

Moneta

Achaemenid coinage

Memory/Money

Mnemosyne

Afonso de Albuquerque

 
You Goa Fonzi de Albuquerque, buy that news and sell that rumor...

Cryptocurrency and crime

The criminal practice of money laundering carried out in cyberspace through online transactions has been termed as cyber-laundering. Money launderers are constantly looking for new ways to avoid detection from law enforcement, and the Internet has opened a large window of opportunities for them.

There’s a new way to break quantum cryptography

Quantum communication promises a perfectly secure way to transmit private messages—in theory. The reality is turning out to be somewhat different.

Can Blockchains Survive the Quantum Computer?

Money is Memory

Those who cannot remember the past are condemned to repeat it.”–George Santayana, The Life of Reason, 1905
 
Just ask Davy Crockett...

Cleansing of the Temple

Representation theory is a branch of mathematics that studies abstract algebraic structures by representing their elements as linear transformations of vector spaces, and studies modules over these abstract algebraic structures. In essence, a representation makes an abstract algebraic object more concrete by describing its elements by matrices and its algebraic operations (for example, matrix addition, matrix multiplication). The theory of matrices and linear operators is well-understood, so representations of more abstract objects in terms of familiar linear algebra objects helps glean properties and sometimes simplify calculations on more abstract theories.

In the study of the representation theory of Lie groups, the study of representations of SU(2) is fundamental to the study of representations of semisimple Lie groups.

Implementing the Drude Polarizable Force Field in NAMD

 Theoretical and Computational Biophysics Group

Professor Datta explains the difference between p-n junctions is a totally different device from the FET, Field Effect Transistor and I have been researching material crystals in research for physics and engineering as FET are used to construct solar cells, so, we understand FET's with nanoelctronics via crystal lattice optimization dhyk paths with perovskite and we consider organic FET's from reading professor Datta's book and may consider with quantum biology quantum computing:
 

This same metaphor is also echoed from the scientist's side: "β sheets do not show a stiff repetitious regularity but flow in graceful, twisting curves, and even the α-helix is regular more in the manner of a flower stem, whose branching nodes show the influence of environment, developmental history, and the evolution of each part to match its own idiosyncratic function."[12]
The β-sheet (also β-pleated sheet) is a common motif of regular secondary structure in proteins. Beta sheets consist of beta strands (also β-strand) connected laterally by at least two or three backbone hydrogen bonds, forming a generally twisted, pleated sheet. A β-strand is a stretch of polypeptide chain typically 3 to 10 amino acids long with backbone in an extended conformation. The supramolecular association of β-sheets has been implicated in formation of the protein aggregates and fibrils observed in many human diseases, notably the amyloidoses such as Alzheimer's disease.

Two-dimensional materials

we may also consider applications in physics for quantum biology research
The electron inelastic mean free path (IMFP) is an important quantity for electron spectroscopy and microscopy techniques. ... The experimental and theoretical results show that the IMFP for monolayer graphene is almost constant (about 1 nm) in the energy range of 6–100 eV.

Surjective function

Injective function

From Carbon, Graphene, consider Myocyte being composed of Sodium, Calcium, Magnesium and Potassium:

Quantum biology research considerations with model theory and

Consider molecular motors and ability to do work as myosin nanomedicine
Myosins are a large family of cytoskeletal motor proteins that bind actin and use the energy of ATP hydrolysis to perform diverse functions such as cell motility and contractility, cytokinesis, intracellular trafficking and muscle contraction.

Synaptic clustering within dendrites: An emerging theory of memory formation

Author links open overlay panelGeorgeKastellakisaDenise J.CaibSara C.MednickcAlcino J.SilvabPanayiotaPoirazi

Synaptic Clustering and Memory Formation

George Kastellakis and Panayiota Poirazi*

The clustering of synapses may emerge from synapses receiving similar input, or via many processes which allow for cross-talk between nearby synapses within a dendritic branch, leading to cooperative plasticity.

Myosin: The Actin Motor Protein

Who are we going to hire for this tiny job task innovating nanomedicine?

Nano--Robotics in Medical Applications: Robotics in Medical Applications: From Science Fiction to Reality
Constantinos Mavroidis, Ph.D., Professor
Bio Nanorobotics Laboratory
Department of Mechanical and Industrial Engineering

Northeastern University, Boston, Massachusetts

Transportin 3 gene bubble babies Wu Long Jiao Zhu Writhe Applications in DNA topology, Micro-Managing Myocyte Mitosis, CpG islands and python programing mathematical Myocyte models

The mutation of Transportin 3 gene that causes limb girdle muscular dystrophy 1F induces protection against HIV-1 infection

Novel mutation in TNPO3 causes congenital limb-girdle myopathy with slow progression

Anna Vihola, Johanna Palmio, Olof Danielsson, Sini Penttilä, Daniel Louiselle, Sara Pittman, Conrad Weihl, Bjarne Udd
 

Limb-girdle muscular dystrophy 1F is caused by a microdeletion in the transportin 3 gene

Maria J Melià  1 Akatsuki KubotaSaida OrtolanoJuan J VílchezJosep GámezKurenai TanjiEduardo BonillaLluís PalenzuelaIsrael Fernández-CadenasAnna PristoupilováElena García-ArumíAntoni L AndreuCarmen NavarroMichio HiranoRamon Martí

Black Box Accounting

Transportin-3

Spanish scientists make breakthrough identifying HIV resistance gene

A rare genetic mutation that causes a form of muscular dystrophy affecting the limbs also protects against HIV infection

TNPO3 Gene

Thanks for the lithography lessons Carole Zoom. Some of these principles may be utilized in medical arts and medical schools of innovation:
A nanoparticle or ultrafine particle is usually defined as a particle of matter that is between 1 and 100 nanometres in diameter. The term is sometimes used for larger particles, up to 500 nm, or fibers and tubes that are less than 100 nm in only two directions.
 
So TNPO3 protects against HIV infection as a plus side to the mutation of the gene causing muscular dystrophy and the AIDS virus has been used in an experimental gene therapy to develop immune systems with 'bubble baby' disease.

David Vetter

David the Bubble Boy

CCR5

CCR5: From Natural Resistance to a New Anti-HIV Strategy


CCR5 C-C motif chemokine receptor 5 [ Homo sapiens (human) ]

American scientist played more active role in ‘CRISPR babies’ project than previously known


Linkage disequilibrium

Wrinkling crystallography on spherical surfaces

Haplotype

A haplotype (haploid genotype) is a group of alleles in an organism that are inherited together from a single parent.[1][2]

See also

Quantum Clustering Algorithms


Hamiltonian (quantum mechanics)

...
However, complications can arise in the many-body problem. Since the potential energy depends on the spatial arrangement of the particles, the kinetic energy will also depend on the spatial configuration to conserve energy. The motion due to any one particle will vary due to the motion of all the other particles in the system.
...

Molecular Hamiltonian

Nonequilibrium Dissipation-free Transport in F1-ATPase and the Thermodynamic Role of Asymmetric Allosterism

Abstract

F1-ATPase (or F1), the highly efficient and reversible biochemical engine, has motivated physicists as well as biologists to imagine the design principles governing machines in the fluctuating world. Recent experiments have clarified yet another interesting property of F1; the dissipative heat inside the motor is very small, irrespective of the velocity of rotation and energy transport. Conceptual interest is devoted to the fact that the amount of internal dissipation is not simply determined by the sequence of equilibrium pictures, but also relies on the rotational-angular dependence of nucleotide affinity, which is a truly nonequilibrium aspect. We propose that the totally asymmetric allosteric model (TASAM), where adenosine triphosphate (ATP) binding to F1 is assumed to have low dependence on the angle of the rotating shaft, produces results that are most consistent with the experiments. Theoretical analysis proves the crucial role of two time scales in the model, which explains the universal mechanism to produce the internal dissipation-free feature. The model reproduces the characteristic torque dependence of the rotational velocity of F1 and predicts that the internal dissipation upon the ATP synthesis direction rotation becomes large at the low nucleotide condition.

System administrator

phreak 

Researching system administration
by
Eric Arnold Anderson
Doctor of Philosophy in Computer Science
University of California at Berkeley
2002
 

Floquet theory

Cat state

Time crystal

Broken symmetry in discrete time crystals

Higher-order and fractional discrete time crystals in clean long-range interacting systems

Consider my other SBIR research article:

Fibrifold a fibroblast with Cure CMD and the reticular fibers!

Fractal Nanotechnology

GF Cerofolini,1 D Narducci,1 P Amato,2 and E Romanocorresponding author1

Intron

Self-splicing occurs for rare introns that form a ribozyme, performing the functions of the spliceosome by RNA alone. There are three kinds of self-splicing introns, Group I, Group II and Group III. Group I and II introns perform splicing similar to the spliceosome without requiring any protein.

Iteration

Structural biology

Protein topology

Self‑splicing by group I introns (pre‑rRNA of Tetrahymena)

Group I and group II introns 

by R Saldanha

Protein structure prediction

Fractal Landscapes and Molecular Evolution: Modeling the Myosin HeavyChain Gene Family
S. V. Buldyrev,* A. L. Goldberger,* S. HavIin,* C-K. Peng,* H. E. Stanley,* M. H. R. Stanley,* and M. Simons*§

Preon

Exciton

Point group

Crystallography

X-ray crystallography (XRC)

Biological macromolecular crystallography

Cryo bio-crystallography 

Exitron

Exon shuffling

Exon skipping

In molecular biology, exon skipping is a form of RNA splicing used to cause cells to “skip” over faulty or misaligned sections (exons) of genetic code, leading to a truncated but still functional protein despite the genetic mutation.

exon skipping drugs approved for DMD
drug exon company UD FDA approval
eteplirsen 51 Sarepta September 2016
golodirsen 53 Sarepta December 2019
viltolarsen 53 NS Pharma August 2020
casimerson45SareptaMarch 2021

Dicer

Gene silencing

A common COL6A1 deep-intronic pseudo-exon inserting mutation causes a distinct phenotype of Ullrich congenital muscular dystrophy

  • A. Reghan Foley
  • S. Donkervoort
  • V. Bolduc

  • D. MacArthur
  • F. Muntoni
  • C. Bönnemann

Exon-Skipping Oligonucleotides Restore Functional Collagen VI by Correcting a Common COL6A1 Mutation in Ullrich CMD

HaiyanZhou45

A recurrent COL6A1 pseudoexon insertion causes muscular dystrophy and is effectively targeted by splice-correction therapies

RNA polymerase

DNA shuffling

RNA interference

RNA splicing

RNA editing

Trans-activating crRNA (tracrRNA)

DNA sequencing

Exon-intron database 

DNA Walking and Rolling Nanomachine for Electrochemical Detection of miRNA

Peng Miao, Yuguo Tang

Sequence based prediction of enhancer regions from DNA random walk

Nanomedicine

Nanomedicine is the medical application of nanotechnology. Nanomedicine ranges from the medical applications of nanomaterials and biological devices, to nanoelectronic biosensors, and even possible future applications of molecular nanotechnology such as biological machines.

Penrose tiling and Senator Penrose on the road with Truman and Eisenhower

By David Vincent Bell Hirsch

Molecular Borromean rings are the molecular counterparts of Borromean rings, which are mechanically-interlocked molecular architectures. In 1997, biologists Chengde Mao and coworkers of New York University succeeded in constructing a set of rings from DNA.[10] In 2003, chemist Fraser Stoddart and coworkers at UCLA utilised coordination chemistry to construct a set of rings in one step from 18 components.[9]

Fractals in the Body

Not only are fractals in the world all around us - they are even INSIDE us! In fact, many of our internal organs and structures display fractal properties.

Molecular tweezers Electron donor Lone pair Angle changes of some Hairy ball theorem

By David Vincent Bell Hirsch

Alpha helix

The β-sheet (also β-pleated sheet) is a common motif of regular secondary structure in proteins. Beta sheets consist of beta strands (also β-strand) connected laterally by at least two or three backbone hydrogen bonds, forming a generally twisted, pleated sheet. A β-strand is a stretch of polypeptide chain typically 3 to 10 amino acids long with backbone in an extended conformation.

Breakthrough in materials discovery enables 'twistronics' for bulk systems

Van der Waals surface

Continuum mechanics

David Vincent Bell Hirsch

The Continuing Story Of Bungalow Bill (Remastered 2009)

 Consistent van der Waals Radii for the Whole Main Group
Manjeera Mantina, Adam C. Chamberlin, Rosendo Valero, Christopher J. Cramer, and
Donald G. Truhlar
 

If no other force is present, the distance between atoms at which the force becomes repulsive rather than attractive as the atoms approach one another is called the Van der Waals contact distance; this phenomenon results from the mutual repulsion between the atoms' electron clouds.[1] The Van der Waals force has the same origin as the Casimir effect, which arises from quantum interactions with the zero-point field.[2]

The Van der Waals forces [3] are usually described as a combination of the London dispersion forces between "instantaneously induced dipoles",[4] Debye forces between permanent dipoles and induced dipoles, and the Keesom force between permanent molecular dipoles whose rotational orientations are dynamically averaged over time.

If no other forces are present, the point at which the force becomes repulsive rather than attractive as two atoms near one another is called the van der Waals contact distance. This results from the electron clouds of two atoms unfavorably coming into contact. It can be shown that van der Waals forces are of the same origin as that of the Casimir effect, arising from quantum interactions with the zero-point field.

The van der Waals heterostructures are an active frontier for discovering emergent phenomena in condensed matter systems. They are constructed by stacking elements of a large library of two-dimensional materials that couple together through van der Waals interactions. However, the number of possible combinations within this library is staggering, so fully exploring their potential is a daunting task. Here, we introduce van der Waals metamaterials to rapidly prototype and screen their quantum counterparts.
and for Fracton twistronics and spintronic sake of innovation

Two-dimensional semiconductor

2021 quantum materials roadmap

van der Waals metamaterials

William Dorrell, Harris Pirie, S. Minhal Gardezi, Nathan C. Drucker, and Jennifer E. Hoffman
Phys. Rev. B 101, 121103(R) – Published 5 March 2020

Van der Waals constants (data page)

Van der Waerden test of maximum clique problem with Waring's conjecture upon Van der Waals force

By David Vincent Bell Hirsch

Opto-spintronics

Spectroscopy of dimers, trimers and larger clusters of linear molecules

Motivation and the Hartree Product

Hartree equation

Hard spheres

Sphere

Applications of quantum mechanics

Magnetic resonance (quantum mechanics)

Molecular orbital

Hybrid functional

Antibonding Orbital Definition

Roothaan equations

General Atomic and Molecular Electronic Structure System (GAMESS (US)) is computer software for computational chemistry program.[1][2][3][4][5] The original code started on October 1, 1977 as a National Resources for Computations in Chemistry project.[6] In 1981, the code base split into GAMESS (US) and GAMESS (UK) variants, which now differ significantly. GAMESS (US) is maintained by the members of the Gordon Research Group at Iowa State University.[7] GAMESS (US) source code is available as source-available freeware, but is not open-source software, due to license restrictions.

List of quantum chemistry and solid state physics software 

Structural Biochemistry/Chemical Bonding/Van der Waals interaction

Operator (mathematics)

Laplace operator

Linear combination of atomic orbitals

Semi-empirical quantum chemistry method

Comparing Lattice Energy for Ionic Compounds Using Coulomb's Law

Parametrization (geometry)

Parametric equation

J. Chem. Phys. 124, 074101 (2006); https://doi.org/10.1063/1.2170089

Bispinor

Microcanonical ensemble

Molecular physics

Ergodic hypothesis

Ergodicity

 

Slutsky Equation, Roy�s Identity and Shephard's Lemma

Logic of relatives

Charles Sanders Peirce

Identity (mathematics)

Charles Sanders Peirce

Arity

Arity (/ˈærɪti/ (About this soundlisten)) is the number of arguments or operands taken by a function or operation in logic, mathematics, and computer science. In mathematics, arity may also be named rank,[1][2] but this word can have many other meanings in mathematics. In logic and philosophy, it is also called adicity and degree.[3][4] In linguistics, it is usually named valency.[5]

What Does Tilde (~) Mean?

The tilde (~) is a character in the standard ASCII character set that is provided on a conventional computer keyboard and is used in both writing and computer programming. It corresponds to ASCII code 126.

The tilde is also sometimes known as the twiddle.
The tilde symbol ~ in physics means “of the order of". It is not the same as other symbols which mean, asymptotically equal to, approximately equal to etc. But “of the order of" can be interpreted differently depending on context. A working definition is, “within a factor of 10".

Positron

Onium

onium (plural oniums) (chemistry) any cation derived by the addition of a proton to the hydride of any element of the nitrogen, chalcogen or halogen families. (chemistry) any organic derivative of these compounds.

Onium ion

ONIOM

The ONIOM (short for 'Our own n-layered Integrated molecular Orbital and Molecular mechanics') method is a computational approach developed by Morokuma and co-workers. ONIOM is a hybrid method that enables different ab initio or semi-empirical methods to be applied to different parts of a molecule/system in combination to produce reliable geometry and energy at reduced computational cost.[1][2][3]

The ONIOM computational approach has been found to be particularly useful for modeling biomolecular systems[4] as well as for transition metal complexes and catalysts.[5]

Comparison of software for molecular mechanics modeling

QM/MM

Calculating the energy of the combined system

Many body localization

Hamiltonian (quantum mechanics)

Dirac formalism

Heisenberg-Langevin formalism for


Circuit Quantum Electrodynamics
David Isaac Schuster


DMAIC (Define - Measure - Analyze - Improve - Control) projects, Design for Six Sigma (DFSS) is an Engineering design process, business process management method related to traditional Six Sigma.[1] It is used in many industries, like finance, marketing, basic engineering, process industries, waste management, and electronics. It is based on the use of statistical tools like linear regression and enables empirical research similar to that performed in other fields, such as social science.

Muscle loss can cause a range of health problems as we age – but it can be prevented

An ethical axis of muscle atrophy in space, sarcopenia with aging and muscular dystrophy from inherited genes exists.

Sarcopenia With Aging

We may collectively consciously consider ethical due process

Preserve your muscle mass

February 19, 2016

Declining muscle mass is part of aging, but that does not mean you are helpless to stop it.

The muon is one of the fundamental subatomic particles, the most basic building blocks of the universe as described in the Standard Model of particle physics. Muons are similar to electrons but weigh more than 207 times as much. That's about the difference between an adult person and a small elephant.

How a tiny, wobbling particle could unlock mysteries of the universe

The results of a new muon experiment are stirring up particle physics.

Song and dance for

Oxyanion

Nuclear geometry and rapid mitosis ensure asymmetric episome segregation in yeast

Lutz R Gehlen  1 Shigeki NagaiKenji ShimadaPeter MeisterAngela TaddeiSusan M Gasser

math-as-code (Python version)

No matter how much you push the nuclear envelope, it'll still be stationery mail with your nuclear family. Nuclear localization sequence Database of protein domains, families and functional sites

In computational physics and chemistry, the Hartree–Fock (HF) method is a method of approximation for the determination of the wave function and the energy of a quantum many-body system in a stationary state.

Nuclear envelope

The nuclear envelope, also known as the nuclear membrane,[1][a] is made up of two lipid bilayer membranes that in eukaryotic cells surrounds the nucleus, which encases the genetic material.

The nuclear envelope consists of two lipid bilayer membranes: an inner nuclear membrane and an outer nuclear membrane.[4] The space between the membranes is called the perinuclear space. It is usually about 20–40 nm wide.[5][6] The outer nuclear membrane is continuous with the endoplasmic reticulum membrane.[4] The nuclear envelope has many nuclear pores that allow materials to move between the cytosol and the nucleus.[4] Intermediate filament proteins called lamins form a structure called the nuclear lamina on the inner aspect of the inner nuclear membrane and give structural support to the nucleus.[4]

Hell

Township in Michigan
Hell is an unincorporated community in Livingston County in the U.S. state of Michigan. As an unincorporated community, Hell has no defined boundaries or population statistics of its own.
Writing to your nuclear family with post cards can be difficult at camp for certain campers... in Hell... Michigan, hop along bull frog from Frog Texas.

Hip Hop logic of relatives, nephew Pierce, as a  genetic programming (GP) exercise myosin tissue engineering

Eukaryote

CRISPR/Cas9 eukaryotic genome-editing system
PROSITE is a protein database.[1][2] It consists of entries describing the protein families, domains and functional sites as well as amino acid patterns and profiles in them. These are manually curated by a team of the Swiss Institute of Bioinformatics and tightly integrated into Swiss-Prot protein annotation. PROSITE was created in 1988 by Amos Bairoch, who directed the group for more than 20 years. Since July 2018, the director of PROSITE and Swiss-Prot is Alan Bridge.

https://prosite.expasy.org/

The nitrogenous bases in DNA are adenine (A), guanine (G), thymine (T), and cytosine (C). The nitrogenous bases in RNA are the same, with one exception: adenine (A), guanine (G), uracil (U), and cytosine (C)
 
the molecular geometry for this molecule will be linear, with a bond angle of about 180∘

Nucleic acids 

Finding nuclear localization signals

LINQ extends the language by the addition of query expressions, ...
...
and can be used to conveniently extract and process data from arrays,
...
event handlers[1] or monadic parsers.

Expression (computer science)

Anti-CRISPR

Genetic programming 

The kill-switch for CRISPR that could make gene-editing safer

How anti-CRISPR proteins and other molecules could bolster biosecurity and improve medical treatments.

GeneticSharp is a fast, extensible, multi-platform and multithreading C# Genetic Algorithm library that simplifies the development of applications using Genetic Algorithms (GAs).
Can be used in any kind of .NET Core and .NET Framework apps, like ASP .NET MVC, ASP .NET Core, Blazor, Web Forms, UWP, Windows Forms, GTK#, Xamarin and Unity3D games.
 
Say, you know that fishtank in the counselors office? You know, the one where you get those Erdős number of addictive pills, some similar to the one's he used to get?

By Katie Palmer

Helsmoortal-VanDerAA Syndrome (HVDAS) aka ADNP Syndrome is caused by a heterozygous de novo mutation in the ADNP gene on chromosome 20q13.

ADNP syndrome, also known as Helsmoortel-Van Der Aa syndrome, is a neurodevelopmental genetic disorder caused by changes (mutations) in the ADNP gene. These mutations occur spontaneously in the majority (97%) of reported patients, meaning there has been no family history of the disorder (de novo mutations).
The tool, called mediKanren, scanned millions of biomedical abstracts hunting for relationships between existing compounds and the gene involved in the disease.

In seconds, it pinpointed an unexpected target: ketamine.

Ketamine is a medication that has been prescribed to men, women and children since the 1960s, primarily as an anesthetic. In 2000, researchers discovered that ketamine has a powerful effect on depression, especially for patients resistant to treatments with typical antidepressants. 

Results are nearly immediate for clinical depression.


It is legal in Texas and when done right, may treat post traumatic stress as well as depression with extremely fast results.


Like with most everything, moderation and under guidance of a professional as any substance has potential to be abused or used in a manner not prescribed or advised by knowledgeable professionals who have studied in their field and earned a license or degree for their career or occupation.

ADNP Genetics

This condition is caused by mutations in the ADNP gene. This gene is located on the long arm of chromosome 20 (20q13.13).

ADNP has been associated with abnormalities in the autophagy pathway in schizophrenia.[2]

Overview of Autophagy Pathways
Briefly, the autophagy pathway entails the development of a phagophore that envelopes cytoplasmic components and forms a double-membrane autophagosome that subsequently fuses with a lysosome for the digestion of its contents.

Server-side I/O Performance: Node vs. PHP vs. Java vs. Go

 

Sex-Dependent Effects of Cannabis and Cannabinoids: A Translational Perspective

Here is where data scientests are associating Holy Communion of Prozac and Xanax over Bhang for Lord Shiva in a Drug War ushered in by Nixon's Southern Strategy past the Shaffer Commission with Bishop's brawl over denying Biden Communion.
 
One survey of facility directors revealed that, over a 6-year period, 36% had dealt with allegations of a staff member sexually assaulting a patient (7). In another study, 68% of psychiatric nurses reported being sexually harassed at work during the previous year, and 3% reported being sexually assaulted (8)
 

Sort of like Cardinal Law and the raping certain members of the flock in the church.
 
 Cardinal sin
Sex-abuse victims of former priest John Geoghan charge that Cardinal Bernard Law was told of Geoghan’s criminal activity as early as 1984 but did nothing to stop it.

CCHR Warns: Psychiatric Sexual Assault of Patients is all too Common Occurrence

Sexual crimes committed by psychiatrists are estimated at 37 times greater than rapes occurring in the general community

Speak Out About Psychiatrist/Psychologist Sexual Abuse

What are the ethics of getting a pateient addicted to a Benzo or other drug? Are the ethical rules similar to a pimp pushing blow for snowflakes (caucasians)? It seems that a liscence to push pejorative pills that are addictive are poorly backed by data driven evidence in some cases of iatrogenesis practiced in bad faith.

Indications for benzodiazepines include acute stress reactions, episodic anxiety, fluctuations in generalised anxiety, and as initial treatment for severe panic and agoraphobia.
What is in your wallet?
(An expensive doctor bill? Quack, quack, quack)
Well how about your neural maps in your connectome?
What does the first amendment have to do with Bhang for Lord Shiva for Sadhus?
Perhaps that person just wanted a CT scan as a check up from the neck up. You know, as scientific data driven evidence with the genetic architecture in his noggin, to make sure he was all crazy as pill pushers prescribe and then some nurse tries to rape him. I'm not sure if a Benzo drug addiction may help by iatrogensis in bad faith. Maybe it is like pedophile priests with the sexual assault of children in some cases. In this case the instution of molecular psychatry itself may have a schism, like the church or even senate.

Billy Crystal got super stoned inside an MRI machine after eating too many weed gummies, then asked his doctor for Taco Bell

SOAP (TV Show 1977) Herbie Goes On - Season 1 Episode 6

What Is a SOAP API? SOAP is a standard communication protocol system that permits processes using different operating systems like Linux and Windows to communicate via HTTP and its XML. SOAP based APIs are designed to create, recover, update and delete records like accounts, passwords, leads, and custom objects 
 
SOAP (abbreviation for Simple Object Access Protocol) is a messaging protocol specification for exchanging structured information in the implementation of web services in computer networks. Its purpose is to provide extensibility, neutrality and independence. It uses XML Information Set for its message format, and relies on application layer protocols, most often Hypertext Transfer Protocol (HTTP), although some legacy systems communicate over Simple Mail Transfer Protocol (SMTP), for message negotiation and transmission.

 

Disinhibition

Why did soap get Cancelled?
Series creator Susan Harris has indicated that, had she known the show was going to be cancelled, it wouldn't have ended on a cliffhanger. ... Though the show's ratings were still good in season four, ABC cancelled the series because of continued pressure from the so-called “moral majority.”

Benson (TV series)

Matthew 5:44 New King James Version (NKJV)

44 But I say to you, love your enemies, bless those who curse you, do good to those who hate you, and pray for those who spitefully use you and persecute you,

take (something) on faith

To accept something without further verifying or investigating, based on trust.


 

 

 

 

 

 

 

JSON vs SOAP

SOAP vs. REST: A Look at Two Different API Styles  

Bad faith is double mindedness or double heartedness in duplicity, fraud, or deception. It may involve intentional deceit of others, or self-deception. The expression "bad faith" is associated with "double heartedness", which is also translated as "double mindedness".

The Hungarian-American psychiatrist and writer Thomas Szasz, who has died aged 92, was regarded by many as the leading 20th- and 21st-century moral philosopher of psychiatry and psychotherapy

The Myth of Mental Illness: Foundations of a Theory of Personal Conduct is a 1961 book by the psychiatrist Thomas Szasz, in which the author criticizes psychiatry and argues against the concept of mental illness.

Sexual Abuse of Minors by Catholic Clergy

Dr. Richard Fitzgibbons, M.D. and Dale O'Leary, Mrs.

Vagus Nerve as Modulator of the Brain–Gut Axis in Psychiatric and Inflammatory Disorders

A degree of a radical argument as

CRUD is an acronym for CREATE, READ, UPDATE and DELETE which are basic functions of persistent storage. CRUD operations can use forms or an interface view to retrieve and return data from a database. Procedures. Function.

Dielectric

Debye relaxation

Debye toroidal moment of surface plasmons as SBIR ESCO model

By David Vincent Bell Hirsch

Quantitative structure–activity relationship

(QSAR models)

Matched molecular pair analysis

Electromagnetism is a property of spacetime itself, study finds

July 23, 2021 by Jussi Lindgren and Jukka Liukkonen

Matched molecular pair analysis (MMPA)

Reaction path Hamiltonian for polyatomic molecules

Curry–Howard correspondence

Statistics (scipy.stats)

31 SWIG and Python

GUI

Patrick Smyth

Entry point

In computer programming, an entry point is a point in a program where the execution of a program begins, and where the program has access to command line arguments. [1]

Peirce's law

Currying

Lazy evaluation... that is hilarious! What get in a Curry anywho?

Quantum entanglement

From Wikipedia, the free encyclopedia
  (Redirected from Spooky action at a distance)

Hall word

Markov odometer

Dyck language

Currying

These are some awesome mathematical and computer science terms!

Curry

Dish
Curry is a variety of dishes originating in the Indian subcontinent. It uses a combination of spices or herbs, usually including ground turmeric, cumin, coriander, ginger, and fresh or dried chilies. In southern India, curry leaves from the curry tree are also an integral ingredient

Biomarkers and Biosensors

Detection and Binding to Biosensor Surfaces and Biomarkers Applications

Book • 2014

we may address

A nine-month investigation by the Guardian and Consumer Reports found alarming levels of forever chemicals, arsenic and lead in samples taken across the US

How to test your drinking water

Get in a Curry... spicy hot

By SUSAN MONTOYA BRYAN

Bicyclic semigroup

In mathematics, the bicyclic semigroup is an algebraic object important for the structure theory of semigroups. Although it is in fact a monoid, it is usually referred to as simply a semigroup. It is perhaps most easily understood as the syntactic monoid describing the Dyck language of balanced pairs of parentheses. Thus, it finds common applications in combinatorics, such as describing binary trees and associative algebras.

noun: octogenarian; plural noun: octogenarians
  1. a person who is from 80 to 89 years old.
In mathematics, a band (also called idempotent semigroup) is a semigroup in which every element is idempotent (in other words equal to its own square). Bands were first studied and named by A. H. Clifford (1954); the lattice of varieties of bands was described independently in the early 1970s by Biryukov, Fennemore and Gerhard.[1] Semilattices, left-zero bands, right-zero bands, rectangular bands, normal bands, left-regular bands, right-regular bands and regular bands, specific subclasses of bands that lie near the bottom of this lattice, are of particular interest and are briefly described below.

Firewalking is the act of walking barefoot over a bed of hot embers or stones. Firewalking has been practiced by many people and cultures in all parts of the world, with the earliest known reference dating back to Iron Age India c. 1200 BC.

Bicyclic groupoids extreme sport of

Magma (algebra)

In abstract algebra, a magma, binar[1] or groupoid is a basic kind of algebraic structure. Specifically, a magma consists of a set equipped with a single binary operation that must be closed by definition. No other properties are imposed.

Free magma

Magma (from Ancient Greek μάγμα (mágma) meaning "thick unguent"[1]) is the molten or semi-molten natural material from which all igneous rocks are formed.[2] Magma is found beneath the surface of the Earth, and evidence of magmatism has also been discovered on other terrestrial planets and some natural satellites.[3] Besides molten rock, magma may also contain suspended crystals and gas bubbles.[4

Z-factor

The Z-factor is a measure of statistical effect size. It has been proposed for use in high-throughput screening (where it is also known as Z-prime,[1] and commonly written as Z' to judge whether the response in a particular assay is large enough to warrant further attention.

(say it like an American impersonating a French person, Z-Factor...)
In mathematics, a factorisation of a free monoid is a sequence of subsets of words with the property that every word in the free monoid can be written as a concatenation of elements drawn from the subsets. The Chen–Fox–Lyndon theorem states that the Lyndon words furnish a factorisation. The Schützenberger theorem relates the definition in terms of a multiplicative property to an additive property

Harping about busking an opera for the Pecan festival here in Austin, Texas nutty heart of Texas capitalism: 
In abstract algebra, the free monoid on a set is the monoid whose elements are all the finite sequences (or strings) of zero or more elements from that set, with string concatenation as the monoid operation and with the unique sequence of zero elements, often called the empty string and denoted by ε or λ, as the identity element.

Hey, the monoid is free... with a

All models are wrong

"All models are wrong" is a common aphorism in statistics; it is often expanded as "All models are wrong, but some are useful".

PyStan

Hessian matrix

Use in optimization

See also

Symmetry of second derivatives

Harpo and Chico Marx molecular orbital reaction to Groucho

Second derivative

Anderson–Darling test

Eigenvalues and eigenvectors

Confidence interval

Scalar field

Examples in quantum theory and relativity

TensorFlow Probability is a library for probabilistic reasoning and statistical analysis.

Parametric statistics

 

Monoid

In abstract algebra, a branch of mathematics, a monoid is a set equipped with an associative binary operation and an identity element.

Monoids are semigroups with identity. Such algebraic structures occur in several branches of mathematics.

For example, the functions from a set into itself form a monoid with respect to function composition. More generally, in category theory, the morphisms of an object to itself form a monoid, and, conversely, a monoid may be viewed as a category with a single object.

In computer science and computer programming, the set of strings built from a given set of characters is a free monoid. Transition monoids and syntactic monoids are used in describing finite-state machines. Trace monoids and history monoids provide a foundation for process calculi and concurrent computing.

In theoretical computer science, the study of monoids is fundamental for automata theory (Krohn–Rhodes theory), and formal language theory (star height problem).

Intermarket Relationships: Following the Cycle

Machine learning may help even if you are not a bicyclic octogenarian semigroup population sampling in Schubert Calculus just yet

How Bonds Affect the Stock Market

Which Investment Is Better for You?


Variational transition-state theory

Wavelet packet decomposition

Mexican hat wavelet

O'Lay

DNA-binding domain

The so called ‘Superformula’ has been developed for the creation of different kind of tubes, usable for gullet and colons.

Digestion and intestines

3D Juliaquat: zn+1 = c * (cos(zn)2 - sin(zn)2)^(2)

http://www.fractal.org/Julius-Ruis-Gallery/Fractalary/quatjulia-c-super-JR5.fim



A signal peptide (sometimes referred to as signal sequence, targeting signal, localization signal, localization sequence, transit peptide, leader sequence or leader peptide) is a short peptide (usually 16-30 amino acids long) present at the N-terminus of the majority of newly synthesized proteins that are destined towards the secretory pathway.

The Golgi apparatus, also called Golgi complex or Golgi body, is a membrane-bound organelle found in eukaryotic cells (cells with clearly defined nuclei) that is made up of a series of flattened stacked pouches called cisternae. It is located in the cytoplasm next to the endoplasmic reticulum and near the cell nucleus.  The endoplasmic reticulum is a type of organelle found in eukaryotic cells that forms an interconnected network of flattened, membrane-enclosed sacs or tube-like structures known as cisternae. 

A topogenic sequence is a collective term used for a peptide sequence present at nascent proteins essential for their insertion and orienting in cellular membranes.

What is the main function of Golgi apparatus?

It has been likened to the cell's post office. A major function is the modifying, sorting and packaging of proteins for secretion. It is also involved in the transport of lipids around the cell, and the creation of lysosomes. The sacs or folds of the Golgi apparatus are called cisternae.

The endoplasmic reticulum (ER) is a type of organelle found in eukaryotic cells that forms an interconnected network of flattened, membrane-enclosed sacs or tube-like structures known as cisternae. The membranes of the ER are continuous with the outer nuclear membrane. The endoplasmic reticulum occurs in most types of eukaryotic cells, but is absent from red blood cells and spermatozoa.

Duality theory for distributive lattices

In mathematics, duality theory for distributive lattices provides three different (but closely related) representations of bounded distributive lattices via Priestley spaces, spectral spaces, and pairwise Stone spaces.
Protein targeting or protein sorting is the biological mechanism by which proteins are transported to their appropriate destinations in the cell or outside it.

The on–off switch of CRISPR immunity against phages in Escherichia coli

Francisco J. M. Mojica, César Díez-Villaseñor

crRNA and tracrRNA guide Cas9-mediated DNA interference in Streptococcus thermophilus

Tautvydas Karvelis, 1 , Giedrius Gasiunas, 1 , Algirdas Miksys, 1 Rodolphe Barrangou, 2 Philippe Horvath, 3 and Virginijus Siksnys 1 ,*
 
The piezoresistive effect is a change in the electrical resistivity of a semiconductor or metal when mechanical strain is applied. In contrast to the piezoelectric effect, the piezoresistive effect causes a change only in electrical resistance, not in electric potential.

A Priestley space is an ordered topological space (X,τ,≤), i.e. a set X equipped with a partial order and a topology τ, satisfying the following two conditions:
  1. (X,τ) is compact.
  2. If ,then there exists a clopen up-set U of X such that xU and yU. (This condition is known as the Priestley separation axiom.)

Genetic algorithm

Chemical laws are those laws of nature relevant to chemistry. The most fundamental concept in chemistry is the law of conservation of mass, which states that there is no detectable change in the quantity of matter during an ordinary chemical reaction. Modern physics shows that it is actually energy that is conserved, and that energy and mass are related; a concept which becomes important in nuclear chemistry. Conservation of energy leads to the important concepts of equilibrium, thermodynamics, and kinetics.

The laws of stoichiometry, that is, the gravimetric proportions by which chemical elements participate in chemical reactions, elaborate on the law of conservation of mass. Joseph Proust's law of definite composition says that pure chemicals are composed of elements in a definite formulation; we now know that the structural arrangement of these elements is also important.

Dalton's law of multiple proportions says that these chemicals will present themselves in proportions that are small whole numbers (i.e. 1:2 O:H in water); although in many systems (notably biomacromolecules and minerals) the ratios tend to require large numbers, and are frequently represented as a fraction. Such compounds are known as non-stoichiometric compounds.

The third stoichiometric law is the law of reciprocal proportions, which provides the basis for establishing equivalent weights for each chemical element. Elemental equivalent weights can then be used to derive atomic weights for each element.

More modern laws of chemistry define the relationship between energy and transformations.

  • In equilibrium, molecules exist in mixture defined by the transformations possible on the timescale of the equilibrium, and are in a ratio defined by the intrinsic energy of the molecules—the lower the intrinsic energy, the more abundant the molecule.
  • Transforming one structure to another requires the input of energy to cross an energy barrier; this can come from the intrinsic energy of the molecules themselves, or from an external source which will generally accelerate transformations. The higher the energy barrier, the slower the transformation occurs.
  • There is a hypothetical intermediate, or transition structure, that corresponds to the structure at the top of the energy barrier. The Hammond-Leffler Postulate states that this structure looks most similar to the product or starting material which has intrinsic energy closest to that of the energy barrier. Stabilizing this hypothetical intermediate through chemical interaction is one way to achieve catalysis.
  • All chemical processes are reversible (law of microscopic reversibility) although some processes have such an energy bias, they are essentially irreversible.
Chip plays the Organ for legislator
 SBIR & STTR Research Priorities
In the context of art, zoomorphism could describe art that imagines humans as non-human animals.[1]

Serenity Sells suggests Wu Long Jiao Zhu with

Writhe

Applications in DNA topology

DNA will coil if you twist it, just like a rubber hose or a rope will, and that is why biomathematicians use the quantity of writhe to describe the amount a piece of DNA is deformed as a result of this torsional stress. In general, this phenomenon of forming coils due to writhe is referred to as DNA supercoiling and is quite commonplace, and in fact in most organisms DNA is negatively supercoiled.[1]

Any elastic rod, not just DNA, relieves torsional stress by coiling, an action which simultaneously untwists and bends the rod. F. Brock Fuller shows mathematically[5] how the “elastic energy due to local twisting of the rod may be reduced if the central curve of the rod forms coils that increase its writhing number”.

See also

CpG islands and python programing mathematical Myocyte models

Island algorithm

M. Heath Farris1,4*, Andrew R. Scott1, Pamela A. Texter1, Marta Bartlett1, Patricia Coleman2and David Masters
 

Micro-Managing Myocyte Mitosis

and
Carole Zoom, here is more interesting research for quantum biology, quantum architecture innovations in Deep Learning:

The dopamine hypothesis of reward.
Reinforcement is sometimes called a retroactive effect on learning because it occurs after the behaviour that is being reinforced (it affects the still-active memory trace of the behaviour, not the behaviour itself).

Dopaminergic pathways

Reptilian Brain, Reptation

Reptation

The Lizard in the clouds? Oh sure, a dancing Wu Long Jiao Zhu!

Glossary of dance moves

What exactly is the 'spin' of subatomic particles such as electrons and protons?Does it have any physical significance, analogous to the spin of a planet?

Spin-up refers to the process of a hard disk drive or optical disc drive accelerating its platters or inserted optical disc from a stopped state to an operational speed. The period of time taken by the drive to perform this process is referred to as its spin-up time, the average of which is reported by hard disks as a S.M.A.R.T. attribute. The required operational speed depends on the design of the disk drive. Typical speeds of hard disks have been 2400, 3600, 4200, 5400, 7200, 10000 and 15000 revolutions per minute (RPM). Achieving such speeds can require a significant portion of the available power budget of a computer system, and so application of power to the disks must be carefully controlled. Operational speed of optical disc drives may vary depending on type of disc and mode of operation (see Constant linear velocity).

A Spin up (Chinese: 烏龍絞柱; pinyin: Wu Long Jiao Zhu; lit. 'Black dragon coils around the pillar') is a Ditangquan technique of Wushu similar to the kip up, where the body is lifted from a lying position to a standing position. The main difference to the kip up is the momentum is generated with a circular leg movement in conjunction with the torso twisting, weight shifting to the upper body and then the hands push off the ground, thus achieving elevation of the entire body. The spin up is also variously called a Star kip up, Black Dragon, Mini-Mill and 180 kip up.

The Ox year of 2021 is under the influence of the metal element, just like the Year of the Rat 2020. This year predicts new career opportunities, so don't let anxiety or negative thinking affect you. Those who are born under the Ox sign are independent and strong people, but very stubborn.

For gymnastics and martial art sake!

Spin

It's more about a particle's identity than its merry-go-round motion.

Zeeman Splitting 

Why do spin-up and spin-down states have different energies?

Spin (physics)

Do not break the dancer doing the robot.

Electron Spin

Bright Week 2021 began on
Sunday
,
May 2
and ends on
Saturday
,
May 8

Dancing with the stars Texas Two Stepping with the Masked Singer

Free Action

Hey cousin Chris Hirsch, your dog's name is Broccoli, so you and your dog may enjoy this article:

What fractals, Fibonacci, and the golden ratio have to do with cauliflower

Self-selected mutations during domestication drastically changed shape over time

Conformal symmetry

Rotational invariance

Monte Carlo methods for numerical simulation

adreno chips, and Arduino hardware innovation design with

Autophagosome-Lysosome Fusion

Author links open overlay panelPéterLőrincz12
GáborJuhász13

"Fusion" is applied in many schools of higher education as a term for Physics, for Psychology, for Biology and has a different meaning for each specific field of study.

I am researching stem cell therapy and tissue engineering with quantum biology in research articles for UT IC2 Deep Learning projects.

By David Vincent Bell Hirsch

Square lattice Ising model

Spin ice

Drude model

You know how models can be

Stoner model of ferromagnetism

Philosopher's Stone

In mathematics, a Stone algebra, or Stone lattice, is a pseudo-complemented distributive lattice such that a* ∨ a** = 1. They were introduced by Grätzer & Schmidt (1957) and named after Marshall Harvey Stone.

Boolean algebras are Stone algebras, and Stone algebras are Ockham algebras.

Examples:

In mathematics, a Stone algebra, or Stone lattice, is a pseudo-complemented distributive lattice such that a* ∨ a** = 1. They were introduced by Grätzer & Schmidt (1957) and named after Marshall Harvey Stone.

Boolean algebras are Stone algebras, and Stone algebras are Ockham algebras.

Examples:

Stone Algebras - Computer Science and Software

Walter Guttmann

Google’s time crystal discovery is so big, we can’t fully comprehend it

Time translation symmetry

What the

Phase transition

Going through a phase, eh?
People do that, you know.
It would be nice if parents had maps for when their children or grandchildren go through a phase.

List of chaotic maps

Honey, I shrunk the kids

Neural coding

Perceptron

Connectome

Each skeletal muscle fiber is a single cylindrical muscle cell. An individual skeletal muscle may be made up of hundreds, or even thousands, of muscle fibers bundled together and wrapped in a connective tissue covering. Each muscle is surrounded by a connective tissue sheath called the epimysium.







Minerals: Their Functions and Sources









Mesenchymal stem cell









Allotransplantation






Conclusions

Overall, our findings suggest that stem cell therapy can potentially provide a new avenue for the treatment of COL6 CMD and other muscular disorders and injuries.

Quantum Biology Spintronic consideration of

The three collagen VI genes and α chains

α chainsSize (kDa)Corresponding
gene
Gene
position
α1(VI)140COL6A121q22.3
α2(VI)140COL6A221q22.3
α3(VI)260–330*COL6A32q37

Spin chemistry

Radical-pair mechanism

Collagen Type VI-Related Disorders

Anne Katrin Lampe, MD, Kevin M Flanigan, MD, Katharine Mary Bushby, MD, MBCHB FRCP, and Debbie Hicks, PhD.

If no other force is present, the distance between atoms at which the force becomes repulsive rather than attractive as the atoms approach one another is called the Van der Waals contact distance; this phenomenon results from the mutual repulsion between the atoms' electron clouds.[1] The Van der Waals force has the same origin as the Casimir effect, which arises from quantum interactions with the zero-point field.[2]

The Van der Waals forces [3] are usually described as a combination of the London dispersion forces between "instantaneously induced dipoles",[4] Debye forces between permanent dipoles and induced dipoles, and the Keesom force between permanent molecular dipoles whose rotational orientations are dynamically averaged over time.

If no other forces are present, the point at which the force becomes repulsive rather than attractive as two atoms near one another is called the van der Waals contact distance. This results from the electron clouds of two atoms unfavorably coming into contact. It can be shown that van der Waals forces are of the same origin as that of the Casimir effect, arising from quantum interactions with the zero-point field.

Luke 11:11 If a son shall ask bread of any of you that is a father, will he give him a stone?

Sermon... I was thinking about the London Dispersion forces as the  Van der Waals force plays a fundamental role in fields as diverse as supramolecular chemistry, structural biology, polymer science, nanotechnology, surface science, and condensed matter physics. It also underlies many properties of organic compounds and molecular solids, including their solubility in polar and non-polar media.

In mathematics, a Stone algebra, or Stone lattice, is a pseudo-complemented distributive lattice such that a* ∨ a** = 1. They were introduced by Grätzer & Schmidt (1957) and named after Marshall Harvey Stone.

Boolean algebras are Stone algebras, and Stone algebras are Ockham algebras.

Examples:

Use the Van Der Waals force Luke 11:11

Priestley space

In mathematics, a Priestley space is an ordered topological space with special properties. Priestley spaces are named after Hilary Priestley who introduced and investigated them.[1] Priestley spaces play a fundamental role in the study of distributive lattices. In particular, there is a duality ("Priestley duality"[2]) between the category of Priestley spaces and the category of bounded distributive lattices.[3][4]

Disorder Persists in Larger Graphs, New Math Proof Finds

David Conlon and Asaf Ferber have raised the lower bound for multicolor “Ramsey numbers,” which quantify how big graphs can get before patterns inevitably emerge.
Ask a Rabbi about a

As pope steps down, disinformation permeates Vatican crackdown on nuns

GlobalPost

February 27, 2013 · 11:31 AM UTC

Introduction to the Sermon on the Mount

Now when Jesus saw the crowds, he went up on a mountainside and sat down. His disciples came to him, and he began to teach them.

The Beatitudes

He said:

“Blessed are the poor in spirit,
    for theirs is the kingdom of heaven. 
 
To say that people are “full of piss and vinegar” is to say that they are brimming with energy. 
Although many speakers assume the phrase must have a negative connotation, 
this expression is more often used as a compliment, “vinegar” being an old slang term for enthusiastic energy. 
 
It is interesting to note Galvani and Volta were both Italian as well Guglielmo Marconi, and Bruno Pontecorvo... for piss and vinegar sake, froggy!

Vinegar tasters

What Does Bad Breath 

Have to Do with Diabetes?

An odor of ammonia is associated with kidney disease. Well, how do you like that?

Ammonium ions are formed in the breakdown of amino acids

A Secret Database of Child Abuse

A former Jehovah's Witness is using stolen documents to expose allegations that the religion has kept hidden for decades.

By Douglas Quenqua 

Rule of law

Brownian motor

Moses (Hebrew: מֹשֶׁה‬‎) is a religious prophet who first appeared in "Jewbilee". He is a member of the Super Best Friends.

William Shatner: Captain's Log

2005 ‧ Documentary ‧ 50 mins

Jewbilee

seriously?

S-matrix

In social philosophy, objectification is the act of treating a person, or sometimes an animal,[1] as an object or a thing. It is part of dehumanization, the act of disavowing the humanity of others. Sexual objectification, the act of treating a person as a mere object of sexual desire, is a subset of objectification, as is self-objectification, the objectification of one's self. In Marxism, the objectification of social relationships is discussed as "reification".

A Seamless Garment Philosophy, aka, a Consistent Life Ethic as a spirit in the letter may be coupled with the Bridges transition model or the five stages of grief as taught by Kübler-Ross in a police parent poetry competition between municipality and state department in a coordinated effort to serve the Department of Family and Protective Services.

December 23, 20175:00 AM ET

Pope Francis encourages nun helping trans community in Argentina

The home, called The Coast of Limay, has been described as the first permanent residence in the world dedicated to vulnerable transsexual people.

In-group/Out-group

An in-group is a group of people who identify with each other based on a variety of factors including gender, race, religion, or geography. Our tendency to distinguish between in-group and out-group members has moral implications.

TEXAS ETHICS COMMISSION PDF Version

CHAPTERS 36 & 39, PENAL CODE

Bribery and Corrupt Influence
Abuse of Office

https://www.ethics.state.tx.us/statutes/ch36_39.php

Use the Van Der Waals force Luke 11:11 (in a Priestly space)

London dispersion force

London dispersion forces (LDF, also known as dispersion forces, London forces, instantaneous dipole–induced dipole forces, or loosely as van der Waals forces) are a type of force acting between atoms and molecules.[1] They are part of the van der Waals forces. The LDF is named after the German physicist Fritz London.

The Van der Waals forces [3] are usually described as a combination of the London dispersion forces between "instantaneously induced dipoles",[4] Debye forces between permanent dipoles and induced dipoles, and the Keesom force between permanent molecular dipoles whose rotational orientations are dynamically averaged over time.

Contents

By Philip Pullella

Bible jokes, humor and trivia

Like most college professors, I've seen hilarious errors in student-written papers. Here are two recent ones:

     "There were a lot of times where Jesus would speak to huge crows such as at the Sermon on the Mount."

     "What struck me most was they way they embarrassed the gospel"

"Our mouths were filled with laughter" -- Psalm 126:2

Lincoln Logarithms! (with geological significance somehow for your sister Lilly's sake)

For God and World (Country sold separately, see Simony says as open Sesame )

Chinese: Cantonese: 芝麻開門 (zi1 maa4 hoi1 mun4) Mandarin: 芝麻開門, 芝麻

- Bugs Bunny

Ventral tegmental area

Abstract

Magnesium plays an important role in a large number of cellular processes by acting as a cofactor in enzymatic reactions and transmembrane ion movements.

Bringing virtual and augmented reality to the classroom


I studied at the Mool Sol Won group a little over a decade ago. They would celebrate dance from Korea as part of the study of martial arts. There were dane styles based on animals. The mannerisms of dance would mimic the animal style expressing anthropomorphism This are distinct differences from the architecture of the French with the art of dance. The context of the research article consdiers how would you train a machine to dance for considerations of ACC and Austin Ballet. In the context of art, zoomorphism could describe art that imagines humans as non-human animals.[1]

Training, validation, and test sets

Gene expression programming

Vector (molecular biology)

In molecular cloning, a vector is a DNA molecule used as a vehicle to artificially carry foreign genetic material into another cell, where it can be replicated and/or expressed (e.g., plasmid, cosmid, Lambda phages). A vector containing foreign DNA is termed recombinant DNA. The four major types of vectors are plasmids, viral vectors, cosmids, and artificial chromosomes. Of these, the most commonly used vectors are plasmids.[1] Common to all engineered vectors have an origin of replication, a multicloning site, and a selectable marker.

The vector itself is generally a DNA sequence that consists of an insert (transgene) and a larger sequence that serves as the "backbone" of the vector. The purpose of a vector which transfers genetic information to another cell is typically to isolate, multiply, or express the insert in the target cell. All vectors may be used for cloning and are therefore cloning vectors, but there are also vectors designed specially for cloning, while others may be designed specifically for other purposes, such as transcription and protein expression. Vectors designed specifically for the expression of the transgene in the target cell are called expression vectors, and generally have a promoter sequence that drives expression of the transgene. Simpler vectors called transcription vectors are only capable of being transcribed but not translated: they can be replicated in a target cell but not expressed, unlike expression vectors. Transcription vectors are used to amplify their insert.

The manipulation of DNA is normally conducted on E. coli vectors, which contain elements necessary for their maintenance in E. coli. However, vectors may also have elements that allow them to be maintained in another organism such as yeast, plant or mammalian cells, and these vectors are called shuttle vectors. Such vectors have bacterial or viral elements which may be transferred to the non-bacterial host organism, however other vectors termed intragenic vectors have also been developed to avoid the transfer of any genetic material from an alien species.[2]

Insertion of a vector into the target cell is usually called transformation for bacterial cells,[3] transfection for eukaryotic cells,[4] although insertion of a viral vector is often called transduction.[5]

Lambda

Sequence Embedding for Clustering and Classification

An embedding is a relatively low-dimensional space into which you can translate high-dimensional vectors. Embeddings make it easier to do machine learning on large inputs like sparse vectors representing words.

(mu) is the size of the parent population; l (lambda) is the size of the offspring

Evolution strategies

Genomic imprinting

Nextstrain: real-time tracking of pathogen evolution

Ghosting (behavior)

Einstein's Spooky

Human germline engineering

Ethical and moral debates

Pandemic and Genocide as an exponetial category of abortion and death penalty in context of a Trolley problem:

Does the Trolley Problem Have a Problem?

What if your answer to an absurd hypothetical question had no bearing on how you behaved in real life?

Trolley problem

Gabriel's Horn

Seraphiel (Hebrew שׂרפיאל, meaning "Prince of the High Angelic Order")
...
Israfil could likely be his counterpart in Islam, one of the Archangels and an angel of music with a similar name of the same meaning.  

'the best physics arguments are very philosophical' - Chiara Maletto

LK, LJ, Dual Intuitionistic Logic, and Quantum Logic

Embeddings

Allele frequency

The allele frequency represents the incidence of a gene variant in a population. ... An allele frequency is calculated by dividing the number of times the allele of interest is observed in a population by the total number of copies of all the alleles at that particular genetic locus in the population.

DELTA
Description
The Allele Frequency Net Database (AFND) is a public database which contains frequency information of several immune genes such as Human Leukocyte Antigens (HLA), Killer-cell Immunoglobulin-like Receptors (KIR), Major histocompatibility complex class I chain-related (MIC) genes, and a number of cytokine gene polymorphisms. The Allele Frequency Net Database (AFND) provides a central source, freely available to all, for the storage of allele frequencies from different polymorphic areas in the Human Genome. Users can contribute the results of their work into one common database and can perform database searches on information already available. We have currently collected data in allele, haplotype and genotype format. However, the success of this website will depend on you to contribute your data.

Hill–Robertson effect

She wrote some of the most influential papers in contemporary American philosophy and prompted debates about urgent moral concerns in everyday life.

Published Dec. 3, 2020
February 15, 2011

South Dakota Moves To Legalize Killing Abortion Providers

A bill under consideration in the Mount Rushmore State would make preventing harm to a fetus a “justifiable homicide” in many cases.

Immanuel Kant


In "A Defense of Abortion", Thomson grants for the sake of argument that the fetus has a right to life, but defends the permissibility of abortion by appealing to a thought experiment: You wake up in the morning and find yourself back to back in bed with an unconscious violinist.

Inbreeding

Consanguinity

Royal blood lines have produced inbred royal autocrats via Cousin marriage
Bible head on a silver platter
Herodias is best known for prompting her daughter Salome to have John the Baptist's “head on a silver platter.” Herodias was a Jewish princess. Her parents were Aristobulus, the son of Herod the great, and Bernice, the daughter of Herod the Great's sister, Salome.

According to Josephus,  Salome was first married to her uncle Philip the Tetrarch, after whose death (AD 34), she married her cousin Aristobulus of Chalcis, thus becoming queen of Chalcis and Armenia Minor.
 
World War I cousins
Did you know that at the time of the First World War, the rulers of the world's three greatest nations – King George V of Great Britain and Tsar Nicholas II of Russia on the one hand, and Kaiser Wilhelm II of Germany on the other – were first cousins? Their grandmother was Queen Victoria.

The Family Relationships that Couldn’t Stop World War I

Kant’s Moral Philosophy

Sabr

House of Saud

Royal family
Al Saud dynasty's "Family Tree." 1933. Oil! 

Compare and contrast with

In wild deer and , as in Mormon cults, polygyny is associated with high levels of inbreeding, because it shrinks the number of males contributing to the gene pool and increases the relatedness of the entire community. 

Inbreeding in the Utah Mormons: an evaluation of estimates based on pedigrees, isonymy, and migration matrices

Why People Kill in the Name of God

The role of self-enhancement in religious aggression

Religious violence

A Brief History of Deadly Attacks on Abortion Providers - The ...

Anti-abortion violence

Religious war

According to the Encyclopedia of Wars, out of all 1,763 known/recorded historical conflicts, 123, or 6.98%, had religion as their primary cause. Matthew White's The Great Big Book of Horrible Things gives religion as the primary cause of 11 of the world's 100 deadliest atrocities.

War and religion

Toxicogenomics

“The World's Most Trusted Airline.”

Undecidable problem

In computability theory and computational complexity theory, an undecidable problem is a decision problem for which it is proved to be impossible to construct an algorithm that always leads to a correct yes-or-no answer. The halting problem is an example: it can be proven that there is no algorithm that correctly determines whether arbitrary programs eventually halt when run.

The crazy math of airline ticket pricing

Where is the Delta variant Covid from?
The Delta variant was first detected in India in December 2020 and has now spread to 60 nations, the CDC says. The World Health Organization has designated it the fourth global variant of concern, along with the ones first identified in the United Kingdom, South Africa, and Brazil

Traveling Passenger Problems

The Delta variant was previously known as the “Indian variant”, as it was first found in India. It's one of three sub-lineages of the Indian variant, and is also known as B.1.617.2
Carl de Marcken

List of undecidable problems

Halting problem

A key part of the proof is a mathematical definition of a computer and program, which is known as a Turing machine; the halting problem is undecidable over Turing machines


Real-time tracking of pathogen evolution

Nextstrain is an open-source project to harness the scientific and public health potential of pathogen genome data. We provide a continually-updated view of publicly available data alongside powerful analytic and visualization tools for use by the community. Our goal is to aid epidemiological understanding and improve outbreak response. If you have any questions, or simply want to say hi, please give us a shout at hello@nextstrain.org. 

Texas Legislature 2021

Another Texas GOP lawmaker is attempting to make abortion punishable by the death penalty

Similar bills filed in the Texas Legislature in previous years have failed.

by Shannon Najmabadi March 9, 2021

Trump CDC chief: Coronavirus ‘escaped’ from Chinese lab

The World Health Organization has concluded that theory is “extremely unlikely.”

Critique of the Gestapo and re-education camps for the children:

According to myth, The Alamo honors the resilience and courage of Anglos and Tejanos pitted against Mexican centralism, brutality, and corruption. In fact, The Alamo is all about emancipation and slavery. Slavery separated the Republic of Mexico from the United States.

The Alamo: The First and Last Confederate Monument?

Jorge Cañizares-Esguerra is the Alice Drysdale Sheffield Professor


genocide refugees autonomy and sovereignty

By David Vincent Bell Hirsch

David’s Law: What is it and who benefits?

“David’s Law?” The law is named this way because of the life it honors and the motivation behind the movement. David Bartlett Molak, age 16, took his own life on Monday, January 4, 2016, in his hometown of San Antonio, Texas. David was a son, brother, Eagle Scout and friend to many. David’s passions included hunting, fishing, professional football and playing various games with his family. In the last few months before his death, David became the repetitive target of relentless cyberbullying. The Molak family describes David’s experience as David becoming “overwhelmed with hopelessness after being continuously harassed, humiliated and threatened by a group of students through text messages and social media.”


What is the #1 cause of death for American ages 15 to 30?

Unintentional injury and homicide were the leading causes of death among residents ages 15–24, each accounting for 34.2% and 32.9%, respectively, of all deaths. These were followed by suicide (9.9%) and cancer (5.8%).
The five leading causes of death among teenagers are Accidents (unintentional injuries), homicide, suicide, cancer, and heart disease. Accidents account for nearly one-half of all teenage deaths.

Try not to shoot your mouth off about this to anyone.

Every day, 22 children and teens (1-17) are shot in the United States. Among those:

  • 5 die from gun violence
  • 2 are murdered
  • 17 children and teens survive gunshot injuries
  • 8 are intentionally shot by someone else and survive
  • 2 children and teens either die from gun suicide or survive an attempted gun suicide
  • 8 children and teens are unintentionally shot in instances of family fire — a shooting involving an improperly stored or misused gun found in the home resulting in injury or death

Every day, 316 people are shot in the United States. Among those:

  • 106 people are shot and killed
  • 210 survive gunshot injuries
  • 95 are intentionally shot by someone else and survive
  • 39 are murdered
  • 64 die from gun suicide
  • 10 survive an attempted gun suicide
  • 1 is killed unintentionally
  • 90 are shot unintentionally and survive
  • 1 is killed by legal intervention*
  • 4 are shot by legal intervention and survive
  • 1 died but the intent was unknown
  • 12 are shot and survive but the intent was unknown

Some 260 shooting deaths were recorded over Fourth of July weekend, according to new data.

Spiritual Warfare (Ephesians 6:10-20)

Robert L. (Bob)Deffinbaugh graduated from Dallas Theological Seminary with his Th.M. in 1971. Bob is a pastor/teacher and elder at Community Bible Chapel in Richardson, Texas, and has contributed many of his Bible study series for use by the Foundation

Sell your cloak and buy a thermal nuclear missile?

A Quarter Century of U.S. Support for Occupation

East Timor Truth Commission report uses declassified U.S. documents to call for reparations from U.S. for its support of Indonesian invasion and occupation of East Timor from 1975 until U.N. sponsored vote in 1999

National Security Archive provides more than 1,000 documents to East Timor Truth Commission after Bush Administration refuses cooperation

Recently Declassified British Documents Reveal U.K. Support for Indonesian Invasion and Occupation of East Timor. 1975-1976

National Security Archive Electronic Briefing Book No. 174

Edited by Brad Simpson
Director, Indonesia-East Timor Documentation Project
For more information contact:
Brad Simpson - 609/751-8206

How George H.W. Bush Rode a Fake National Security Scandal to the Top of the CIA

The killing of a CIA agent in Greece was used to thwart reforms as Bush became the first openly partisan director of the spy agency in 1976.

Desperate wives

part 1

Why would everybody be silent?

29 January 2005


Why would the US military ignore 9-11 and other crimes? These excerpts from an interview with Kay Griggs show one reason. Kay Griggs is another woman who wants a better world. Will the men give it to her?

Kay Griggs speaks freely about the unimagined corruption and extent of the oppressive systems of deception within the leadership nexus of military intelligence with secret society internationalism. Kay Griggs, Colonel's Wife, desperate wives, military army sodom marines Tell-All Interview spies system secret 9/11 norwegians nato ,new york, ,"chesty puller", patton joint blackmail homosexual sin


Kay Griggs: Colonel's Wife Deep State Tell-All 2 of 4

And George Bush CIA 1976

East Timor genocide

For the British Royals, Less Majesty Should Be the Way Forward

There are too many working Windsors. Harry’s now employed elsewhere. Maybe Andrew can get less busy too.

Gov. Greg Abbott says he won't impose lockdowns or mask mandates in Texas as it reports the 2nd-most COVID-19 cases in the US

Energy industry showers Gov. Greg Abbott, other Texas politicians with campaign cash after they passed power grid bills

For some energy experts, the increase in donations for the officials at the close of the session looks like a reward for not passing more stringent regulations and raises questions about whether lawmakers let the oil, gas and the broader energy industry off easy for its massive failures.

by Mitchell Ferman and Carla Astudillo Aug. 4, 2021


Tigray conflict plus
Kantian ethics Trolley problems as
Elizabeth Kingston
Grand Valley State University

East Timor

Welcome to the Yale East Timor Project, since 2000 a component of the Genocide Studies Program.

Compare and contrast Pandemic

Alberni Indian Residential School

Port Alberni, British Columbia

Trudeau asks Pope Francis to apologise for schools

Infallibility

Pope Rejects Call for Apology to Canada’s Indigenous People

 
Thanks for taking a Swing (dance)

The weapon dance employs weapons—or stylized versions of weapons—traditionally used in combat in order to simulate, recall, or reenact combat or the moves of combat in the form of dance, usually for some ceremonial purpose. Such dancing is quite common to folk ritual in many parts of the world. Weapon dancing is certainly ancient; among the earliest historical references we have are those that refer to the pyrrhichios, a weapon dance in ancient Sparta, in which the dance was used as a kind of ritual training for battle.[1]

There are virtually no parts of the world left where the weapon dance is directly connected with imminent or recent combat. This is especially true of European states, which have long since moved away from the tribalism that usually gives rise to such folk dances. It is, however, also true of parts of the world where tribal traditions have succumbed to colonialism and the forces of globalism. The dances that one sees today are often part of general movements to preserve and rejuvenate tribal or local traditions. Some of these movements are quite strong now, such as those among native North American tribes and the aboriginal peoples of Australia.

Related to weapon dances and war dances is the dance of the hunt. A very early reference to a weapon dance of the hunt comes in the form of a rock carving at Çatal Höyük, the large neolithic settlement in south-central Anatolia.  

Overview: James

James 1:14
but each person is tempted when they are dragged away by their own evil desire and enticed.

James 4:3
When you ask, you do not receive, because you ask with wrong motives, that you may spend what you get on your pleasures.

Similar concept
Brahmacharya is a concept within Indian religions that literally means to stay in conduct within one's own soul. In Yoga, Hinduism and Jainism it generally refers to a lifestyle characterized by sexual continence or complete abstinence.

Psalm 1:1 Blessed is the man that walketh not in the counsel of the ungodly, nor standeth in the way of sinners, nor sitteth in the seat of the scornful.

Mark 7:20-23 Then He said, “What comes out of a person—that defiles him. For from within, out of people’s hearts, come evil thoughts, sexual immoralities, thefts, murders, adulteries, greed, evil actions, deceit, promiscuity, stinginess, blasphemy, pride, and foolishness. All these evil things come from within and defile a person.”

"To thine own self be true," says Polonius in Hamlet. This phrase has become enormously popular, so much so that there are entire Tumblrs of photographs of people bearing "to thine own self be true" tattoos and other paraphernalia.

And contrary to the opinion of the masses, one's true self, according to Socrates, is not to be identified with what we own, with our social status, our reputation, or even with our body. Instead, Socrates famously maintained that our true self is our soul

Galatians 5:19-21 Now the works of the flesh are obvious: sexual immorality, moral impurity, promiscuity, idolatry, sorcery, hatreds, strife, jealousy, outbursts of anger, selfish ambitions, dissensions, factions, envy, drunkenness, carousing, and anything similar. I tell you about these things in advance—as I told you before—that those who practice such things will not inherit the kingdom of God.

According to legend, and to several Ancient Greek authors including Plato, two words of wisdom were carved into the stone at the entrance of the most important temple of Ancient Greece, the Temple of Apollo in the city of Delphi. Two words that formed the phrase “gnothi seauton,” which literally means “know yourself.”

Know thyself

Romans 8:5-6 For those who live according to the flesh set their minds on the things of the flesh, but those who live according to the Spirit set their minds on the things of the Spirit. For to set the mind on the flesh is death, but to set the mind on the Spirit is life and peace.

Follow your heart or gaurd your heart?

Jeremiah 17:9
The heart is deceitful above all things
    and beyond cure.
    Who can understand it?

Schizophyllum commune have 23,328 sexes

Jeremiah was a bull frog Making quantum leaps from Frog Texas to Hell Michigan with mirror neuron maps within  Quantum Clustering Algorithms

STAR (gene)

DMRT1

DMRT1 is a dose sensitive transcription factor protein that regulates Sertoli cells and germ cells. The DMRT1 gene is located at the end of the 9th chromosome. This gene is found in a cluster with two other members of the gene family, having in common a zinc finger-like DNA-binding motif (DM domain). The DM domain is an ancient, conserved component of the vertebrate sex-determining pathway that is also a key regulator of male development in flies and nematodes, and is found to be the key sex-determining factor in chickens.[8]

Testis-determining factor

sex-determining region Y (SRY) protein
Grab them by the... you behave yourself with such disorders with the orderlies in your ward

Hairy ball theorem

Where does the Bible say guard your heart?
 
Philippians 4:6-7 KJV

And the peace of God, which passeth all understanding, shall keep your hearts and minds through Christ Jesus.

Emotional Agility


I have confessed to Dr. Church at Harvard of being a cheeky monkey.

Shock the Monkey 

Clonal interference is a phenomenon in evolutionary biology, related to the population genetics of organisms with significant linkage disequilibrium, especially asexually reproducing organisms. The idea of clonal interference was introduced by American geneticist Hermann Joseph Muller in 1932.[1] It explains why beneficial mutations can take a long time to get fixated or even disappear in asexually reproducing populations. As the name suggests, clonal interference occurs in an asexual lineage ("clone") with a beneficial mutation. This mutation would be likely to get fixed if it occurred alone, but it may fail to be fixed, or even be lost, if another beneficial-mutation lineage arises in the same population; the multiple clones interfere with each other

Phra Rahu in Thailand

Rāhu (Sanskrit: राहु)(U+260A.svg) is one of the nine major celestial bodies (navagraha) in Hindu texts. Unlike most of the others, Rahu is a shadow entity, one that causes eclipses and is the king of meteors.[1] Rahu represents the ascension of the moon in its precessional orbit around the earth.

Rahu is usually paired with Ketu which is also considered to be a shadow planet. The time of day considered to be under the influence of Rahu is called Rāhu kāla and is considered inauspicious.[2]

As per Hindu astrology, Rahu and Ketu have an orbital cycle of 18 years and are always 180 degrees from each other orbitally (as well as in the birth charts). This coincides with the precessional orbit of the moon or the ~18 year rotational cycle of the lunar ascending and descending nodes on the earth's ecliptic plane. This also corresponds to a saros, a period of approximately 223 synodic months (approximately 6585.3211 days, or 18 years, 11 days, 8 hours), that can be used to predict eclipses of the Sun and Moon. Rahu rules the zodiac sign of Aquarius together with Shani.

Astronomically, Rahu and Ketu denote the points of intersection of the paths of the Sun and the Moon as they move on the celestial sphere. Therefore, Rahu and Ketu are respectively called the north and the south lunar nodes. The fact that eclipses occur when the Sun and the Moon are at one of these points gives rise to the understanding of swallowing of the Sun and the Moon by the snake. Rahu is responsible for causing the Eclipse of the Sun.

Saturn Devouring His Son

Saturn's rippling rings point to massive, soupy core hidden inside

The findings might challenge established models of the formation of gas giants. 

Myocyte COL6A1, COL6A2, COL6A3, gene protein directional development, Fibrifold a fibroblast...

Sword to plowshares includes saber rattling Sabr House of Saud and the Chilean Saber rattling, open carry as a convention of cotton plantation slave owning tools, whip and pistol tools of slave owners to keep those slaves in a slave master server information age.   

CRISPR-Cas9 has changed the landscape, offering a relatively simple, low cost, speedy genetic modification tool. CRISPR-Cas9 has become so democratized that anyone can get everything they need to perform a simple genetic alteration delivered to their door for less than $300

How about that performance art in Austin Texas?

In literary criticism, purple prose is overly ornate prose text that disrupts a narrative flow by drawing undesirable attention to its own extravagant style of writing. This diminishes the appreciation of the prose overall.[1] Purple prose is characterized by the excessive use of adjectives, adverbs, and metaphors. When it is limited to certain passages, they may be termed purple patches or purple passages, standing out from the rest of the work.

Purple prose is criticized for desaturating the meaning in an author's text by overusing melodramatic and fanciful descriptions. As there is no precise rule or absolute definition of what constitutes purple prose, deciding if a text, passage, or complete work has fallen victim is a somewhat subjective decision. According to Paul West, "It takes a certain amount of sass to speak up for prose that's rich, succulent and full of novelty. Purple is immoral, undemocratic and insincere; at best artsy, at worst the exterminating angel of depravity."[2]

Purple is the best mattress tech advancement in 80 years. Our mattresses and pillows come with free delivery, free returns, and a 100-night trial.

OMG I slept on my arm wrong and my left hand fingertips turned PURPLE, I need a new mattress and my parents got me one. This is a very long ode to their testimony of love. Performance art theatrical acts of interfaith spiritual dialog are in order to serve our community:
The purple economy is that part of the economy which contributes to sustainable development by promoting the cultural potential of goods and services. ... It designates an economy that adapts to the human diversity in globalization and that relies on the cultural dimension to give value to goods and services.”

City of the Violet Crown

City of the Violet Crown is a term for at least two cities:

In one of his surviving fragments (fragment 64), the lyric poet Pindar wrote[1] of Athens:

City of light, with thy violet crown, beloved of the poets, thou art the bulwark of Greece.

The climate of Attica is characterised by low humidity and a high percentage of dust in the air, which make sunsets display hues of violet and purple and the surrounding mountains often appear immersed in a purple haze.
In Geoffrey Trease's novel The Crown of Violet, the name is explained as referring to the mauve-tinted marble of the Acropolis hill.
According to the City of Austin's History Center, the phrase first appeared in The Austin Daily Statesman (Now the Austin American Statesman) on May 5th, 1890.[2]
It was long believed to have originated in O. Henry's story "Tictocq: The Great French Detective, In Austin", published in his collection of short stories The Rolling Stone published October 27, 1894.
In chapter 2 of Tictocq, O. Henry writes:

The drawing-rooms of one of the most magnificent private residences in Austin are ablaze of lights. Carriages line the streets in front, and from gate to doorway is spread a velvet carpet, on which the delicate feet of the guests may tread. The occasion is the entrée into society of one of the fairest buds in the City of the Violet Crown.

The phrase is generally thought to refer to the atmospheric phenomenon more commonly known as the Belt of Venus. The phrase is also said to be connected to the moonlight towers of Austin.[3]
Another explanation: during the 19th century, residents began to call Austin the "Athens of the South" for its university. With his sly reference to the poetry of Pindar, O. Henry may have been satirizing Austin's ambitious claim of a cultural link to ancient Athens.[4]
There is a $7,798 mattress from www.tempurpedic.com

Seriously

Let’s talk about the Mattress Money. You know what I am referring to — the stash of $50’s and $100’s you have shoved under the mattress? In a shoebox behind the suitcases in the walk-in closet? Under a loose slat in the floorboards? Taped under the middle drawer of the chest of drawers ? No matter where it is, for the purpose this blog, let’s call it Mattress Money.

Savings 101: The Mattress Money

Deuteronomist

The Deuteronomist, abbreviated as either Dtr[1] or simply D, may refer either to the source document underlying the core chapters (12–26) of the Book of Deuteronomy, or to the broader "school" that produced all of Deuteronomy as well as the Deuteronomistic history of Joshua, Judges, Samuel, and Kings and also the book of Jeremiah.[2] The adjectives "Deuteronomic" and "Deuteronomistic" are sometimes used interchangeably; if they are distinguished, then the first refers to the core of Deuteronomy and the second to all of Deuteronomy and the history.[3][4]

"The Princess and the Pea" (Danish: "Prinsessen paa Ærten"; literal translation: "The Princess on the Pea")[1] is a literary fairy tale by Hans Christian Andersen about a young woman whose royal identity is established by a test of her sensitivity. The tale was first published with three others by Andersen in an inexpensive booklet on 8 May 1835 in Copenhagen by C. A. Reitzel.

Andersen had heard the story as a child, and it likely has its source in folk material, possibly originating from Sweden, as it is unknown in the Danish oral tradition.[1] Neither "The Princess and the Pea" nor Andersen's other tales of 1835 were well received by Danish critics, who disliked their casual, chatty style and their lack of morals.[2]

The tale is classified in the Aarne–Thompson–Uther Index as ATU 704, "The Princess and the Pea".

Pound Cake speech

A Rabbi, a Bishop and a Mullah mosey into a caravanserai:

Who has high score with Whac-A-Mole NOW, the Mullah taunted and teased with game face on. What Khazar trader talk the Rabbi jibbed in. Calling dibs on stonemason caber toss tie breaker rites, the Bishop boldly moved on the money talking.


A joke-crafter's life may impart spirits of all sorts as a jester of courts Modus Tollens investigating the spirit in the letter of the law as well the rule of the law and all the Latin stuff:
 
salus populi suprema lex esto           the good of the people is the supreme law

salvo errore et omissione (s.e.e.o.)      save for error and omission

scilicet (scire licet)                             one is permitted to know

scientia est potentia                             knowledge is power





Money from Koch interests flows to governor candidate Greg Abbott

Perhaps Texas AG Ken Paxton is acting as an official government-actor violating statutory and constitutional provisions in favor of business interests of the petroleum energy lobby:

Energy Firms in Secretive Alliance With Attorneys General

In recent news, the "Texas Observer" ran a news story:

"TCEQ: Contested Coal Mine Can Release Wastewater Into Drinking Supply"

And from the 'Houston Chronicle':

"Texas taxpayer tab for suing feds tops $5 million"


"State Officials Investigated Over Their Inquiry Into Exxon Mobil’s Climate Change Research" from the New York Times:

High Levels of Carcinogen Found in Houston Area After Harvey

A Houston company dumped cancer-causing chemicals into a neighborhood storm drain

Harmful chemical found in Houston drinking water

The cancer-causing chemical chromium 6 has been found at high levels in Houston's tap water, according to the nonprofit Environmental Working Group.

by Carol Flake Nov. 29, 2016

Bridges transition model, CWS DFPS, Grassrootsleadership

followup with a song, a grant, bout something dirty in the water:

“The amount of the loan that was taken out on this facility was just ridiculously too high,”  Maverick County Commissioner Jerry Morales told Bloomberg. “It doesn’t add up.”
Grassrootsleadership, Serenity Sells proposes a musical bridge as a Bridges transition model in Texas music grant song and dance pitch

ACLS Collaborative Research Fellowships

Rabi crops or rabi harvest are agricultural crops that are sown in winter and harvested in the spring in India[1] and Pakistan. The term is derived from the Arabic word for "spring", which is used in the Indian subcontinent, where it is the spring harvest (also known as the "winter crop").The opposite of rabi crops are the kharif crops which are grown after, the rabi and zaid (zaa-id) crops are harvested one after another respectively.

Show me the Mullah: A priestly space in a vacuum Rabi oscillation:

A vacuum Rabi oscillation is a damped oscillation of an initially excited atom coupled to an electromagnetic resonator or cavity in which the atom alternately emits photon(s) into a single-mode electromagnetic cavity and reabsorbs them. Serenity Sells suggests, a microwave photon stored on-chip vacuum Rabi splitting gamma–gamma physics ( photon coupling ) interaction in a magnetic mirror manifold cubic spline. In mathematics, the pin group is a certain subgroup of the Clifford algebra associated to a quadratic space. Priestley spaces play a fundamental role in the study of distributive lattices.

The smectic phases of Liquid crystals (LCs) may be manipulated in a torus, a type of a toroid. In mathematics, a toroid is a doughnut-shaped object, a surface of revolution  forming a solid body.

Serenity Sells suggests Chiral molecule packing may be computed for solutions with Spin and Pin groups as to derive an anapole magnetic torodial moment superimposed upon Soddy Circles allotropes in Quantum superposition.

In bioinformatics, clique-finding algorithms have been used to infer evolutionary trees, predict protein structures, and find closely interacting clusters of proteins.

Gravity's Rainbow is a 1973 novel by American writer Thomas Pynchon.

Rabi crops or rabi harvest are agricultural crops that are sown in winter and harvested in the spring in India.

In Judaism, a rabbi is a teacher of Torah, for priestly space sake! A random seed (or seed state, or just seed) is a number (or vector) used to initialize a pseudorandom number generator. 

Molecular thumb drives: Researchers store digital images in metabolite molecules

In mathematics, the Killing form, named after Wilhelm Killing, is a symmetric bilinear form that plays a basic role in the theories of Lie groups and Lie algebras.

How long do muscle cells live?
10 to 16 years

Juan Liu,1,2,3 Dominik Saul,1 Kai Oliver Böker,1 Jennifer Ernst,1 Wolfgang Lehman,1 and Arndt F. Schilling1,2

This matrix delivers healing stem cells to injured elderly muscles

Muscular dystrophy patients could someday also benefit from this hydrogel successfully tested in mice

Date:
August 15, 2018

Towards stem cell therapies for skeletal muscle repair

npj Regenerative Medicine volume 5, Article number: 10 (2020)

Totally disconnected group

Clique

Clique (graph theory)

The Vision of Ezra is an ancient apocryphal text purportedly written by the biblical scribe Ezra. The earliest surviving manuscripts, composed in Latin, date to the 11th century AD, although textual peculiarities strongly suggest that the text was originally written in Greek. Like the Greek Apocalypse of Ezra, the work is clearly Christian, and features several apostles being seen in heaven. However, the text is significantly shorter than the Apocalypse.

The text has a strong dependence on 2 Esdras, an earlier Apocalypse, and portrays God as answering the prayer of Ezra to have courage by sending him seven angels to show him heaven. In the Latin Vision of Esdras, Ezra walks down three floors or 72 steps and is shown hell. When arriving in hell, a soul approaches Esdras and says your coming here has granted us some respite. From there he is taken to the fourth underworld where the sinners are shown hanging by their eyelashes. The righteous he sees in heaven are portrayed as passing through a vast scene of flames and fire-breathing lions, unharmed. The wicked are also seen to be in heaven, but are quickly ripped apart by vicious dogs, and burnt in the fire. Ezra is told by a nearby angel that the crimes of the wicked were that "they denied the Lord, and sinned with women on the Lord’s Day".

Comparable New Testament verses can be found in Luke 16:22: that the beggar died, and was carried by the angels, and in Jesus' reference to the immortal worm in Mark 9:47–48: in hell, the worms that eat them do not die.

For Jumping Jeremiah performance art sake!

Extremally disconnected space

In mathematics, an extremally disconnected space is a topological space in which the closure of every open set is open. (The term "extremally disconnected" is correct, even though the word "extremally" does not appear in most dictionaries.[1] The term extremely disconnected is sometimes used, but it is incorrect.)

An extremally disconnected space that is also compact and Hausdorff is sometimes called a Stonean space. This is different from a Stone space, which is usually a totally disconnected compact Hausdorff space. In the duality between Stone spaces and Boolean algebras, the Stonean spaces correspond to the complete Boolean algebras.

An extremally disconnected first-countable collectionwise Hausdorff space must be discrete. In particular, for metric spaces, the property of being extremally disconnected (the closure of every open set is open) is equivalent to the property of being discrete (every set is open).

Kind of like a homeless camp


Tottaly Drude...

In mathematics, a Stone algebra, or Stone lattice, is a pseudo-complemented distributive lattice such that a* ∨ a** = 1. They were introduced by Grätzer & Schmidt (1957) and named after Marshall Harvey Stone.

Boolean algebras are Stone algebras, and Stone algebras are Ockham algebras.

Examples:

In mathematics, a Stone algebra, or Stone lattice, is a pseudo-complemented distributive lattice such that a* ∨ a** = 1. They were introduced by Grätzer & Schmidt (1957) and named after Marshall Harvey Stone.

Boolean algebras are Stone algebras, and Stone algebras are Ockham algebras.

Examples:

Hund's rule of maximum multiplicity is a rule based on observation of atomic spectra, which is used to predict the ground state of an atom or molecule with one or more open electronic shells. The rule states that for a given electron configuration, the lowest energy term is the one with the greatest value of spin multiplicity.[1] This implies that if two or more orbitals of equal energy are available, electrons will occupy them singly before filling them in pairs. The rule, discovered by Friedrich Hund in 1925, is of important use in atomic chemistry, spectroscopy, and quantum chemistry, and is often abbreviated to Hund's rule, ignoring Hund's other two rules.

Pauli exclusion principle 

Spin quantum number

Magnetic quantum number

You may know that the oceans cover about 70 percent of the of Earth's surface, and that about 97 percent of all water on and in the Earth is saline—there's a lot of salty water on our planet.

The Alkali family of elements is also known as the lithium family after its leading element.

Alkali metal

All alkali metals have their outermost electron in an s-orbital: this shared electron configuration results in their having very similar characteristic properties.

Pauli looked for an explanation for these numbers, which were at first only empirical. At the same time he was trying to explain experimental results of the Zeeman effect in atomic spectroscopy and in ferromagnetism. He found an essential clue in a 1924 paper by Edmund C. Stoner, which pointed out that, for a given value of the principal quantum number (n), the number of energy levels of a single electron in the alkali metal spectra in an external magnetic field, where all degenerate energy levels are separated, is equal to the number of electrons in the closed shell of the noble gases for the same value of n. This led Pauli to realize that the complicated numbers of electrons in closed shells can be reduced to the simple rule of one electron per state if the electron states are defined using four quantum numbers. For this purpose he introduced a new two-valued quantum number, identified by Samuel Goudsmit and George Uhlenbeck as electron spin.

Hall effect

The Hall effect is the production of a voltage difference (the Hall voltage) across an electrical conductor that is transverse to an electric current in the conductor and to an applied magnetic field perpendicular to the current. It was discovered by Edwin Hall in 1879.[1][2]

Quantum spin Hall effect

Hall words are in one-to-one correspondence with Hall trees. These are binary trees; taken together, they form the Hall set. This set is a particular totally ordered subset of a free non-associative algebra, that is, a free magma.

Hall algebra

Collective animal behavior

Virtual collective consciousness

Social networking service

Brains Might Sync As People Interact — and That Could Upend Consciousness Research

When we cooperate on certain tasks, our brainwaves might synchronize. This finding could upend the current understanding of consciousness.

Social exclusion, marginalization or social marginalisation is the social disadvantage and relegation to the fringe of society. It is a term used widely in Europe and was first used in France.[1] It is used across disciplines including education, sociology, psychology, politics and economics.[2]

Collective consciousness

Collective consciousness, collective conscience, or collective conscious (French: conscience collective) is the set of shared beliefs, ideas, and moral attitudes which operate as a unifying force within society.[1] In general, it does not refer to the specifically moral conscience, but to a shared understanding of social norms.[2] The term was introduced by the French sociologist Émile Durkheim in his The Division of Labour in Society in 1893. The French word conscience generally means "conscience", "consciousness", "awareness",[3] or "perception".[4] Commentators and translators of Durkheim disagree on which is most appropriate, or whether the translation should depend on the context. Some prefer to treat the word 'conscience' as an untranslatable foreign word or technical term, without its normal English meaning.[5] As for "collective", Durkheim makes clear that he is not reifying or hypostasizing this concept; for him, it is "collective" simply in the sense that it is common to many individuals;[6] cf. social fact.

Collective unconscious

Collective unconscious (German: kollektives Unbewusstes) refers to structures of the unconscious mind which are shared among beings of the same species. It is a term coined by Carl Jung. According to Jung, the human collective unconscious is populated by instincts, as well as by archetypes: universal symbols such as The Great Mother, the Wise Old Man, the Shadow, the Tower, Water, and the Tree of Life.[1] Jung considered the collective unconscious to underpin and surround the unconscious mind, distinguishing it from the personal unconscious of Freudian psychoanalysis. He argued that the collective unconscious had profound influence on the lives of individuals, who lived out its symbols and clothed them in meaning through their experiences. The psychotherapeutic practice of analytical psychology revolves around examining the patient's relationship to the collective unconscious.

Psychiatrist and Jungian analyst Lionel Corbett argues that the contemporary terms "autonomous psyche" or "objective psyche" are more commonly used today in the practice of depth psychology rather than the traditional term of the "collective unconscious."[2] Critics of the collective unconscious concept have called it unscientific and fatalistic, or otherwise very difficult to...

Can humans flock?
Scientists at the University of Leeds believe they may have found the answer, with research that shows that humans flock like sheep and birds, subconsciously following a minority of individuals.

You're Flocking Behavior... It is for the Boids!

Boids

Serenity Sells Now!
 
Science Prizes

 Lee Osheroff Richardson Science Prize

Call for nominations

Stanford
cognitive science

Animals Count and Use Zero. How Far Does Their Number Sense Go?

Crows recently demonstrated an understanding of the concept of zero. It’s only the latest evidence of animals’ talents for numerical abstraction — which may still differ from our own grasp of numbers.

Application of the Firefly Algorithm for Solving the Economic Emissions Load Dispatch Problem

Bunch of Boids brains!

Swarm intelligence

Molecular motors are natural (biological) or artificial molecular machines that are the essential agents of movement in living organisms. In general terms, a motor is a device that consumes energy in one form and converts it into motion or mechanical work; for example, many protein-based molecular motors harness the chemical free energy released by the hydrolysis of ATP in order to perform mechanical work.[1] In terms of energetic efficiency, this type of motor can be superior to currently available man-made motors. One important difference between molecular motors and macroscopic motors is that molecular motors operate in the thermal bath, an environment in which the fluctuations due to thermal noise are significant. 
 
A protein superfamily is the largest grouping (clade) of proteins for which common ancestry can be inferred (see homology). Usually this common ancestry is inferred from structural alignment[1] and mechanistic similarity, even if no sequence similarity is evident.[2] Sequence homology can then be deduced even if not apparent (due to low sequence similarity). Superfamilies typically contain several protein families which show sequence similarity within each family. The term protein clan is commonly used for protease and glycosyl hydrolases superfamilies based on the MEROPS and CAZy classification systems.[2][3]

Myosin

Myosins (/ˈməsɪn, --/[1][2]) are a superfamily of motor proteins best known for their roles in muscle contraction and in a wide range of other motility processes in eukaryotes. They are ATP-dependent and responsible for actin-based motility. The term was originally used to describe a group of similar ATPases found in the cells of both striated muscle tissue and smooth muscle tissue.[3] Following the discovery by Pollard and Korn (1973) of enzymes with myosin-like function in Acanthamoeba castellanii, a global range of divergent myosin genes have been discovered throughout the realm of eukaryotes.

Although myosin was originally thought to be restricted to muscle cells (hence myo-(s) + -in), there is no single "myosin"; rather it is a very large superfamily of genes whose protein products share the basic properties of actin binding, ATP hydrolysis (ATPase enzyme activity), and force transduction. Virtually all eukaryotic cells contain myosin isoforms. Some isoforms have specialized functions in certain cell types (such as muscle), while other isoforms are ubiquitous. The structure and function of myosin is globally conserved across species, to the extent that rabbit muscle myosin II will bind to actin from an amoeba.[4]

Some examples of biologically important molecular motors:[2]

  • Cytoskeletal motors
  • Polymerisation motors
    • Actin polymerization generates forces and can be used for propulsion. ATP is used.
    • Microtubule polymerization using GTP.
    • Dynamin is responsible for the separation of clathrin buds from the plasma membrane. GTP is used.
  • Rotary motors:
    • FoF1-ATP synthase family of proteins convert the chemical energy in ATP to the electrochemical potential energy of a proton gradient across a membrane or the other way around. The catalysis of the chemical reaction and the movement of protons are coupled to each other via the mechanical rotation of parts of the complex. This is involved in ATP synthesis in the mitochondria and chloroplasts as well as in pumping of protons across the vacuolar membrane.[3]
    • The bacterial flagellum responsible for the swimming and tumbling of E. coli and other bacteria acts as a rigid propeller that is powered by a rotary motor. This motor is driven by the flow of protons across a membrane, possibly using a similar mechanism to that found in the Fo motor in ATP synthase.
Molecular dynamics simulation of a synthetic molecular motor composed of three molecules in a nanopore (outer diameter 6.7 nm) at 250 K.[4]
  • Nucleic acid motors:
    • RNA polymerase transcribes RNA from a DNA template.[5]
    • DNA polymerase turns single-stranded DNA into double-stranded DNA.[6]
    • Helicases separate double strands of nucleic acids prior to transcription or replication. ATP is used.
    • Topoisomerases reduce supercoiling of DNA in the cell. ATP is used.
    • RSC and SWI/SNF complexes remodel chromatin in eukaryotic cells. ATP is used.
    • SMC proteins responsible for chromosome condensation in eukaryotic cells.[7]
    • Viral DNA packaging motors inject viral genomic DNA into capsids as part of their replication cycle, packing it very tightly.[8] Several models have been put forward to explain how the protein generates the force required to drive the DNA into the capsid; for a review, see [1]. An alternative proposal is that, in contrast with all other biological motors, the force is not generated directly by the protein, but by the DNA itself.[9] In this model, ATP hydrolysis is used to drive protein conformational changes that alternatively dehydrate and rehydrate the DNA, cyclically driving it from B-DNA to A-DNA and back again. A-DNA is 23% shorter than B-DNA, and the DNA shrink/expand cycle is coupled to a protein-DNA grip/release cycle to generate the forward motion that propels DNA into the capsid.
  • Enzymatic motors:
    • Catalase
    • Urease
    • Aldolase
    • Hexokinase
    • Phosphoglucose isomerase
    • Phosphofructokinase
    • Glucose Oxidase
  • Synthetic molecular motors have been created by chemists that yield rotation, possibly generating torque.[citation neede

Minimum spanning tree

Protein–ligand complex

A protein–ligand complex is a complex of a protein bound with a ligand[2] that is formed following molecular recognition between proteins that interact with each other or with various other molecules. Formation of a protein-ligand complex is based on molecular recognition between biological macromolecules and ligands, where ligand means any molecule that binds the protein with high affinity and specificity. Molecular recognition is not a process by itself since it is part of a functionally important mechanism involving the essential elements of life like in self-replication, metabolism, and information processing. For example DNA-replication depends on recognition and binding of DNA double helix by helicase, DNA single strand by DNA-polymerase and DNA segments by ligase. Molecular recognition depends on affinity and specificity. Specificity means that proteins distinguish the highly specific binding partner from less specific partners and affinity allows the specific partner with high affinity to remain bound even if there are high concentrations of less specific partners with lower affinity.[3]

In organic chemistry, a bent bond, also known as a banana bond, is a type of covalent chemical bond with a geometry somewhat reminiscent of a banana. The term itself is a general representation of electron density or configuration resembling a similar "bent" structure within small ring molecules, such as cyclopropane (C3H6) or as a representation of double or triple bonds within a compound that is an alternative to the sigma and pi bond model.

Tissue Engineering

Tissue engineering (TE) is a rapidly evolving discipline that seeks to repair, replace or regenerate tissues or organs by translating fundamental knowledge in physics, chemistry and biology into practical and effective materials, or devices and clinical strategies.37,38

Applications for Muscular Dystrophy:


The Python programing language may model solutions


applying


As to model:

Collagen alpha-2(VI) chain is a protein that in humans is encoded by the COL6A2 gene.

in context of

Variants in the COL6A1, COL6A2, and COL6A3 Genesin Collagen VI-related Congenital Muscular Dystrophy (P2.042)


A signal peptide (sometimes referred to as signal sequence, targeting signal, localization signal, localization sequence, transit peptide, leader sequence or leader peptide) is a short peptide (usually 16-30 amino acids long) present at the N-terminus of the majority of newly synthesized proteins that are destined towards the secretory pathway.

Brownian motor

Examples in nature

Proteins acting as Brownian motors inside human cells

Splicing Life: A Report on the Social and Ethical Issues of GeneticEngineering with Human Beings 1982

Donald S. Fredrickson

"The possibilities presented by gene therapy and gene surgery may in fact call into quaestion a central element of democratic political theory and practice: the commitment to equality of opportunity."

democratic political theory

One theory holds that democracy requires three fundamental principles: upward control (sovereignty residing at the lowest levels of authority), political equality, and social norms by which individuals and institutions only consider acceptable acts that reflect the first two principles of upward control and political ...democracy as a system of government with four key elements: i) A system for choosing and replacing the government through free and fair elections; ii) Active participation of the people, as citizens, in politics and civic life; iii) Protection of the human rights of all citizens; and iv) A rule of law

What is commitment to equal opportunities?
An equal opportunities policy is a formal manifesto that sets out an organisation's commitment to fairness. It also lays down guidelines on how it will deal with issues that contravene these guidelines. The equal opportunities policy of an organisation does not have to be long and complicated.

Equality of opportunity is about treating people fairly and without bias and about creating conditions in the workplace and wider society that encourage and value diversity and promote dignity.

BEA is committed to providing equal opportunity and equal access to ... of the Workforce Innovation and Opportunity Act (WIOA) (29 USC 3248)

https://www.nhworks.org/about-us/equal-opportunity-moa/

29 CFR § 38.25 - A grant applicant's obligation to provide a written assurance.

Bio Ethics

Leon R. Kass, M.D., Ph.D

Human germline engineering

Texas judge says parents whose kids need an ICU bed will have to 'wait for another child to die'

Ethos or the ethical appeal, means to convince an audience of the author's credibility or character. An author would use ethos to show to his audience that he is a credible source and is worth listening to. ... Pathos or the emotional appeal, means to persuade an audience by appealing to their emotions.

Can a citizen appeal to the Supreme Court?
 
When a party brings a claim originally in a federal district court, then either party can appeal the outcome of the trial to a federal circuit court, and, after the circuit court rules, either party can appeal to the US Supreme Court, although the Supreme Court has discretion on whether to hear it (more on that below).

Can I Appeal Any Case to the Supreme Court of the United States?

Texas Courts of Appeals

"What we have here is a failure to communicate" - The Captains Speech "Cool Hand Luke" (1967)

A schism (pronounced /ˈsɪzəm/ SIZ-əm, /ˈskɪzəm/ SKIZ-əm or, less commonly, /ˈʃɪzəm/ SHIZ-əm[1]) is a division between people, usually belonging to an organization, movement, or religious denomination. The word is most frequently applied to a split in what had previously been a single religious body, such as the East–West Schism or the Great Western Schism. It is also used of a split within a non-religious organization or movement or, more broadly, of a separation between two or more people, be it brothers, friends, lovers, etc.

A schismatic is a person who creates or incites schism in an organization or who is a member of a splinter group. Schismatic as an adjective means pertaining to a schism or schisms, or to those ideas, policies, etc. that are thought to lead towards or promote schism.

Shepard's Citations

Shepard's Citations is a citator used in United States legal research that provides a list of all the authorities citing a particular case, statute, or other legal authority.[1] The verb Shepardizing (sometimes written lower-case) refers to the process of consulting Shepard's to see if a case has been overturned, reaffirmed, questioned, or cited by later cases.[1] Although the name is trademarked, it is also used informally by legal professionals to describe citators in general[citation needed]—for example, Westlaw's similar electronic citator called KeyCite. Prior to the development of electronic citators like KeyCite during the 1990s, Shepard's was the only legal citation service that attempted to provide comprehensive coverage of U.S. law.[1]

Let us cite a Military case example:

Schism v. United States, 316 F.3d 1259 (Fed. Cir. 2002), was a case decided by the United States Court of Appeals for the Federal Circuit, on appeal from the United States Court of Federal Claims arising out of a 1998 lawsuit brought against the United States in an attempt to ensure that military benefits promised in exchange for military service would continue.[1] Ultimately, the Federal Circuit heard the case en banc and denied the benefits requested by the plaintiffs, leaving it to Congress to fashion a solution.[1] It has been described as "[o]ne of the most important cases the court decided" in the area of military pay and benefits.[2]

Welfare economics

John Rawls
 

Island (Huxley novel)

Procreative beneficence and the prospective parent


In "A Defense of Abortion", Thomson grants for the sake of argument that the fetus has a right to life, but defends the permissibility of abortion by appealing to a thought experiment: You wake up in the morning and find yourself back to back in bed with an unconscious violinist.

Antithesis is used in writing or speech either as a proposition that contrasts with or reverses some previously mentioned proposition, or when two opposites are introduced together for contrasting effect. This is based on the logical phrase or term.


  1. Julian Savulescu
Robert Nozick

Utilitarianism

Collective action problem

Moses Stuttered, both Jacob and Sampson had a limp as well there are some interpritations that the Queen of Sheba hid a disability as she was royalty and had to put up apperances. She even attempted to hide her disability from Solomon

Queen of Sheba

A notable example in the Old Testament for the topic of communication disorders relates to Moses. ... Exodus 4:10-13—And Moses said unto the Lord, O my Lord, I am not eloquent, neither heretofore, nor since thou has spoken unto thy servant: but I am slow of speech, and of a slow tongue.

A Biblical Approach to Treating Stuttering

by Richard Mallard
from Texas, USA


How did Queen of Sheba tested Solomon?
King Solomon has heard of Sheba and her great kingdom. ... The Queen of Sheba tests Solomon's wisdom, asking him many questions and giving him riddles to solve. He answers to her satisfaction and then he teaches her about his god Yahweh and she becomes a follower.
The Solomonic dynasty (Amharic: ሰሎሞናዊው ሥርወ መንግሥት, romanizedSälomonawīwi širiwä menigišiti), also known as the House of Solomon, was a dynasty of the Ethiopian Empire formed in the thirteenth century. Its members claim lineal descent from the biblical King Solomon and the Queen of Sheba. Tradition asserts that the queen gave birth to Menelik I after her biblically described visit to Solomon in Jerusalem.[1] In 1270, Zagwe dynasty was overthrown by Yekuno Amlak, who claimed descent from Solomon and founded the Solomonic era of Ethiopia. The dynasty lasted until 1974, ended by a coup d'état and the deposition of Haile Selassie, who was a Solomonic prince through his grandmother.

According to Ethiopian tradition, the Ark of the Covenant is preserved in the ancient holy city of Aksum. For centuries, the great relic was kept in the Church of Mary of Zion, where the emperor Iyasu is recorded as having seen it and spoken to it in 1691.

Church of Our Lady Mary of Zion

In moral philosophy, deontological ethics or deontology (from Greek: δέον, 'obligation, duty' + λόγος, 'study') is the normative ethical theory that the morality of an action should be based on whether that action itself is right or wrong under a series of rules, rather than based on the consequences of the action.[1] It is sometimes described as duty-, obligation-, or rule-based ethics.[2][3] Deontological ethics is commonly contrasted to consequentialism,[4] virtue ethics, and pragmatic ethics. In this terminology, action is more important than the consequences.

A conservative Catholic media organization, The Pillar, has published several reports claiming the use of dating apps at several churches and the Vatican.

Fact-checking Lt. Gov. Dan Patrick's false claim that Black Texans are driving COVID surge

Report: Allegations Of Priests Using Grindr Have Unnerved The Catholic Church

AARON : Descendants of, ordained priests forever (Exodus 28:40-43;29:9; Numbers 3:3;18:1; 1 Chronicles 23:13; 2 Chronicles 2)

The Bible and homosexuality

David and Jonathan, Ruth and Naomi

The account of David and Jonathan in the Books of Samuel has been interpreted by traditional and mainstream writers as a relationship of affectionate regard. It has also been interpreted by some authors as of a sexual nature.[15][16] Theologian Theodore Jennings identifies the story as one of desire for David by both Saul and Jonathan, stating, "Saul's jealousy has driven [David] into Jonathan's arms."[17] Michael Coogan addresses the claim of the alleged homosexual relationship between David and Jonathan and explicitly rejects it.[18]

The story of Ruth and Naomi is also occasionally interpreted by contemporary scholars as the story of a lesbian couple.[19][20] Coogan states that the Hebrew Bible does not even mention lesbianism.[21]

Romani people

The Romani people are widely known in English by the exonym Gypsies (or Gipsies)

Ashkenazi Jews

Ten Lost Tribes

The Jewish historian Josephus (37–100 AD) wrote that "there are but two tribes in Asia and Europe subject to the Romans, while the ten tribes are beyond Euphrates till now, and are an immense multitude, and not to be estimated by numbers".[3]

Israeli scholar creates Jewish-Gypsy Forum after discovering biblical link between Jews and Romani people. Since publishing his research findings, he says, he has been contacted by thousands of members of the Romani community, and hundreds have been flocking to Israel for meetings with the forum members.

Here is Standford with bioinformatics for geneological record keeping:
Did the ancient cultures express celestial mechanics with songs and dance as symbolic logic expressed in mythology "Big and Jiggly, all Sloshing Around"?

Gosford Glyphs

' When did Egypt come to Australia?

'Australia was discovered in the Third Dynasty [about 5000 years ago]. The Egyptians landed at Cape York Peninsula and moved south,'' Dr von Senff said. Much of his work has been based on the research of Queensland Egyptologist Ray Johnson, who claimed to have done a transcription of the Kariong hieroglyphics
 

Saint Sarah

Saint Sarah, also known as Sara la Kali ("Sara the Black", Romani: Sara e Kali), is the patron saint of the Romani people. The center of her veneration is Saintes-Maries-de-la-Mer, a place of pilgrimage for Roma in the Camargue, in Southern France. Legend identifies her as the servant of one of the Three Marys, with whom she is supposed to have arrived in the Camargue.[1]

Pilgrimage[edit]

The day of the pilgrimage honouring Sarah is May 24; her statue is carried down to the sea on this day to re-enact her arrival in France.

Some authors have drawn parallels between the ceremonies of the pilgrimage and the worship of the Hindu goddess Kali (a form of Durga), subsequently identifying the two.[5] Ronald Lee (2001) states:

If we compare the ceremonies with those performed in France at the shrine of Sainte Sara (called Sara e Kali in Romani), we become aware that the worship of Kali/Durga/Sara has been transferred to a Christian figure... in France, to a non-existent "sainte" called Sara, who is actually part of the Kali/Durga/Sara worship among certain groups in India.[6]

The name "Sara" itself is seen in the appellation of Durga as Kali in the famed text Durgasaptashati.[7]


Surya Siddhanta

The Sūrya Siddhānta (lit.'Sun treatise') is a Sanskrit treatise in Indian astronomy in fourteen chapters.[1][2][3] The Surya Siddhanta describes rules to calculate the motions of various planets and the moon relative to various constellations, and calculates the orbits of various astronomical bodies.[4][5] The text is known from a 15th-century CE palm-leaf manuscript, and several newer manuscripts.[6] It was composed or revised c. 800 CE from an earlier text also called the Surya Siddhanta.[3]

According to Indian astrophysicist Jayant Narlikar, the knowledge of Surya Siddhanta came from Greek astrology. However, this view is based on an interpolated text found in Anandashrama Pune[7] and not found in any other version. As per him the field of astrology in India likely developed in the centuries after the arrival of Greek astrology with Alexander the Great, their zodiac signs being nearly identical.[8]

According to al-Biruni, the 11th-century Persian scholar and polymath, a text named the Surya Siddhanta was written by one Lāta.[6] The second verse of the first chapter of the Surya Siddhanta attributes the words to an emissary of the solar deity of Hindu mythology, Surya, as recounted to an asura (a mythical being) called Maya at the end of Satya Yuga, the first golden age of Hindu mythology, around two million years ago.[6][9]

The text asserts, according to Markanday and Srivatsava, that the earth is of a spherical shape.[2] It treats Sun as stationary globe around which earth and other planets orbit, It calculates the earth's diameter to be 8,000 miles (modern: 7,928 miles),[4] the diameter of the moon as 2,400 miles (actual ~2,160)[4] and the distance between the moon and the earth to be 258,000 miles[4] (now known to vary: 221,500–252,700 miles (356,500–406,700 kilometres).[10] The text is known for some of earliest known discussion of sexagesimal fractions and trigonometric functions.[11][12][13]

The Surya Siddhanta is one of the several astronomy-related Hindu texts. It represents a functional system that made reasonably accurate predictions.[14][15][16] The text was influential on the solar year computations of the luni-solar Hindu calendar.[17] The text was translated into Arabic and was influential in medieval Islamic geography.[18]

Importance in history of science


Shani (Saturn)10,765 days, 18 hours, 33 mins, 13.6 secs10,758 days, 17 hours, 48 mins, 14.9 secs10,759 days, 5 hours, 16 mins, 32.2 secs


Kartik (month)

Kartika, Karthika or Kartik or Kartika maasam is a month in Hindu calendar, that typically overlaps October and November. In the Nepali calendar, Maithili, and Bengali, it is the 7th month, in the Tamil calendar it is the 8th month.

  Hindu goddess Kali (a form of Durga)

Kali Puja, also known as Shyama Puja or Mahanisha Puja,[1] is a festival, originating from the Indian subcontinent, dedicated to the Hindu goddess Kali, celebrated on the new moon day (Dipannita Amavasya) of the Hindu month Kartik especially in the regions of Bengal, and in Mithila, Odisha, Assam and the town of Titwala in Maharashtra.[2] It coincides with the Lakshmi Puja day of Diwali. While the Hindu Bengalis, Odias, Assamese and Maithils worship the goddess Kali[2] on this day, the rest of India and Nepal worships goddess Lakshmi on Diwali.

Saturn (Latin: Sāturnus [saːˈturnus]) was a god in ancient Roman religion, and a character in Roman mythology. He was described as a god of generation, dissolution, plenty, wealth, agriculture, periodic renewal and liberation. Saturn's mythological reign was depicted as a Golden Age of plenty and peace. After the Roman conquest of Greece, he was conflated with the Greek Titan Cronus. Saturn's consort was his sister Ops, with whom he fathered Jupiter, Neptune, Pluto, Juno, Ceres and Vesta.

Saturn was especially celebrated during the festival of Saturnalia each December, perhaps the most famous of the Roman festivals, a time of feasting, role reversals, free speech, gift-giving and revelry. The Temple of Saturn in the Roman Forum housed the state treasury and archives (aerarium) of the Roman Republic and the early Roman Empire. The planet Saturn and the day of the week Saturday are both named after and were associated with him.


Aion (deity)

Aion (Greek: Αἰών) is a Hellenistic deity associated with time, the orb or circle encompassing the universe, and the zodiac.

The "time" which Aion represented is perpetual, unbounded, ritual, and cyclic: The future is a returning version of the past, later called aevum (see Vedic Sanskrit “Ṛtú ”).

Scientific terms... big and jiggly.

Saturn’s insides are sloshing around

A new paper suggests Saturn’s core is more like a fluid than a solid, and makes up more of the planet’s interior than we thought.

MIT adds the scientific term 'sloshing around'

Contractarianism

“Contractarianism” names both a political theory of the legitimacy of political authority and a moral theory about the origin or legitimate content of moral norms.
Slackers!

Deontological Kleshas plank as a southern strategy in the eyes of Dan Patrick's Texas?

The Eyes of Texas are upon you,
All the livelong day.
The Eyes of Texas are upon you,
You cannot get away.
Do not think you can escape them
At night or early in the morn --
The Eyes of Texas are upon you
Til Gabriel blows his horn.
 
Supreme Court of Texas Pro Bono Program

The Supreme Court refers cases to the Program when it requests full briefing on the merits and there is at least one party who is proceeding pro se because of his or her financial circumstances. Parties represented by counsel at the petition stage may also request the Appellate Section's Pro Bono Committee to be included in the Program if Court requests merits briefing as well. A full explanation of the proposed Program is available in the attached Proposal that was adopted by the Supreme Court.

GOVERNMENT CODE


TITLE 2. JUDICIAL BRANCH


SUBTITLE A. COURTS


CHAPTER 22. APPELLATE COURTS


SUBCHAPTER A. SUPREME COURT

 
 
 Carl Jung mask
The persona, for Swiss psychiatrist Carl Jung, was the social face the individual presented to the world—"a kind of mask, designed on the one hand to make a definite impression upon others, and on the other to conceal the true nature of the individual."
 
What are Carl Jung's 12 archetypes?
Twelve archetypes have been proposed for use with branding: Sage, Innocent, Explorer, Ruler, Creator, Caregiver, Magician, Hero, Outlaw, Lover, Jester, and Regular Person.
 
Jungian archetypes are defined as universal, primal symbols and images that derive from the collective unconscious, as proposed by Carl Jung.
 
 
fear and desire are two sides of the same coin

Shadow (psychology)

"Power tends to corrupt, and absolute power corrupts absolutely. Great men are almost always bad men..." - John Emerich Edward Dalberg-Acton, 1st Baron Acton

Enneagram of Personality 

Where love rules, there is no will to power; and where power predominates, there love is lacking. The one is the shadow of the other.

  • Carl Jung, The Psychology of the Unconscious (1943).

System administrator

Server farm

“Silence is such a coin that one side of which failure has and on the other hand holds the success, adopt it wisely.”
Ehsan Sehgal 

Soft skills

Comments

Popular posts from this blog

Uncertainpy for World Toilet Day 2022 PU Learning, QuPath, QuTip SALib for Biomass Multiplexed analysis Ion Gas Cracker Reinforcement Learning as Classification

Pareto principle 80 20 Rule, I O Psychology Quantum cognition modeling Social anhedonia and deficits in reinforcement learning ML | Classification vs Clustering The Jupyter Notebook (Formerly known as the IPython Notebook) Document classification Building Classification Model with Python Unlabeled Data PU-learning-example Building your first Machine Learning Classifier in Python Deconstruction Editorial: Negative and positive data, statistical power, and confidence intervals Classification: True vs. False and Positive vs. Negative Positive-unlabeled learning What is the difference between positive and negative numbers? Labeled and Unlabeled Data- What is the difference?? Hermeneutics Improving Neural Relation Extraction with Implicit Mutual Relations ORACLE An Introduction To Building a Classification Model Using Random Forests In Python Improving Neural Relation Extraction with Positive and Unlabeled Learning The influence of negative training set size on...

Open source government social networking platform with mission to house the homeless, celebrating world toilet day 2021

Austin Texas is the live music capital of the world. Frontsteps Homelessness Programs and Resources noun plural noun : stepping stones a raised stone used singly or in a series as a place on which to step when crossing a stream or muddy area. an action or event that helps one to make progress towards a specified goal. "the school championships are a stepping stone to international competition" End Homelessness Serenity Sells Austin Front Steps, Stepfamily Dance Steps Steppingstones for step children to recover a House the Homeless Texas Dance Party False balance List of countries by oil consumption Horseshoe theory   Fossil Fuels’ Hidden Cost Is in Billions, Study Says By Matthew L. Wald Oct. 19, 2009 1.4 million veterans are at risk of homelessness. The number of veterans experiencing homelessness rose slightly even before the coronavirus pandemic I propose global IPO launches in SBIR blog articles narratives, have done business with BidOptima.com from Hyderabad I...

Piñata Effigy Implicit stereotype Iconoclasm Green Bonds for Artificial neural network Machines learning about Environmental Racism as solutions for Texas Disparity

Attention (machine learning) Embodied cognition 2 Esdras 5 The Second Vision, 5:42 I will compare my judgment to a Circle Cognitive-cultural economy Cognitive-cultural economy or cognitive-cultural capitalism is represented by sectors such as high-technology industry , business and financial services , personal services , the media , the cultural industries . It is characterized by digital technologies combined with high levels of cognitive and cultural labor. Free presentation Human–computer interaction Neural network Slerp Artificial neural network Package ‘neuralnet’ February 7, 2019 Identity matrix Neural coding Artificial neuron Basis function Vector algebra relations Vector calculus identities Vectors in arbitrary dimensions What is Dimensionality? Modulo operation Mode (statistics) Learning high-dimensional data Michel VERLEYSEN Latent variable Degrees of freedom (mechanics) Degrees of freedom (physics and c...