Conference of the Birds invisible dance of CRISPR-Cas9 Closing in on a cure for Duchenne muscular dystrophy
Transcendental realism
Initially developed by Roy Bhaskar in his book A Realist Theory of Science (1975), transcendental realism is a philosophy of science that was initially developed as an argument against epistemic realism of positivism and hermeneutics. The position is based on Bhaskar's transcendental arguments for certain ontological and epistemological positions based on what reality must be like in order for scientific knowledge to be possible.
The overview of transcendental realism that follows is largely based on Andrew Sayer's Realism and Social Science.
Horseshoe theory
Critical realism (philosophy of the social sciences)
Critical realism is a philosophical approach to understanding science initially developed by Roy Bhaskar (1944–2014). It combines a general philosophy of science (transcendental realism) with a philosophy of social science (critical naturalism). It specifically opposes forms of empiricism and positivism by viewing science as concerned with identifying causal mechanisms. In the last decades of the twentieth century it also stood against various forms of postmodernism and poststructuralism by insisting on the reality of objective existence. In contrast to positivism's methodological foundation, and poststructuralism's epistemological foundation, critical realism insists that (social) science should be built from an explicit ontology. Critical realism is one of a range of types of philosophical realism, as well as forms of realism advocated within social science such as analytic realism[1] and subtle realism.[2][3]
Flying Saucer Daffy
The Seven Valleys
The Seven Valleys (Persian: هفت وادی Haft-Vádí) is a book written in Persian by Baháʼu'lláh, the founder of the Baháʼí Faith. The Seven Valleys follows the structure of the Persian poem The Conference of the Birds.
The Seven Valleys is usually published together with The Four Valleys (Persian: چهار وادی Chahár Vádí), which was also written by Baháʼu'lláh, under the title The Seven Valleys and the Four Valleys. The two books are distinctly different and have no direct relation.[citation needed] In February 2019 an authorized translation of both titles and some others was published by the Baháʼí World Centre in the collection The Call of the Divine Beloved.[1]
Rio Grande Valley
The mountains are high as the valleys are low.
Jacob's Ladder
Jacob wrestling with the angel
Jacobian matrix and determinant
Hamilton–Jacobi–Bellman equation
Applications in atomic and molecular physics
See also
N is a Number: A Portrait of Paul Erdős
Filter (mathematics)
He is the Eternal! This is My testimony for her who hath heard My voice and drawn nigh unto Me. Verily, she is a leaf that hath sprung from this preexistent Root. She hath revealed herself in My name and tasted of the sweet savours of My holy, My wondrous pleasure. At one time We gave her to drink from My honeyed Mouth, at another caused her to partake of My mighty, My luminous Kawthar. Upon her rest the glory of My name and the fragrance of My shining robe.
A compilation
from Bahá'í sacred texts and writings of the Guardian
of the Faith and Bahíyyih Khánum's own letters
made by
Samovar
Tasseography
Tasseography (also known as tasseomancy, tassology, or tasseology) is a divination or fortune-telling method that interprets patterns in tea leaves, coffee grounds, or wine sediments.
The terms derive from the French word tasse (cup), which in turn derives from the Arabic loan-word into French tassa, and the Greek suffixes -graph (writing), -logy (study of), and -mancy (divination).
Parousia
Prophecy (Shia Islam)
Great Schism
A random seed (or seed state, or just seed) is a number (or vector) used to initialize a pseudorandom number generator.
For a seed to be used in a pseudorandom number generator, it does not need to be random. Because of the nature of number generating algorithms, so long as the original seed is ignored, the rest of the values that the algorithm generates will follow probability distribution in a pseudorandom manner.
A pseudorandom number generator's number sequence is completely determined by the seed: thus, if a pseudorandom number generator is reinitialized with the same seed, it will produce the same sequence of numbers.
The choice of a good random seed is crucial in the field of computer security. When a secret encryption key is pseudorandomly generated, having the seed will allow one to obtain the key. High entropy is important for selecting good random seed data.[1]
If the same random seed is deliberately shared, it becomes a secret key, so two or more systems using matching pseudorandom number algorithms and matching seeds can generate matching sequences of non-repeating numbers which can be used to synchronize remote systems, such as GPS satellites and receivers.
Random seeds are often generated from the state of the computer system (such as the time), a cryptographically secure pseudorandom number generator or from a hardware random number generator.Seeding (computing)
Argument of a function
Parallel programming model
Parallel Processing and Multiprocessing in Python
List of cluster management software
Comparison of cluster software
Application programming interface key
DeepMind plans to release hundreds of millions of protein structures for free
Why and when to use API keys
Google turns AlphaFold loose on the entire human genome
Using Google Cloud API keys
Google Maps, API Keys
DeepMind Releases Accurate Picture of the Human Proteome – “The Most Significant Contribution AI Has Made to Advancing Scientific Knowledge to Date”
Watering the Seeds of LoveGrowing Mindful Relationships By Jerry Braza Thích Nhất HạnhI am on a mission to cure muscular dystrophy and have proposed girls v. boys with a conference of the Birds invisible dance of of CRISPR-Cas9. Thank you Maggie for help with direction from the Greatest Holy Leaf, Infallible Institutions?by Udo Schaeferpublished in Reason and Revelation: Studies in the Babi and Bahá'í Religions, 13, pages 3-37Los Angeles: Kalimat Press, 2002 Shunning
What is the purpose of shunning? Shunning,
social control mechanism used most commonly in small tight-knit social
groups to punish those who violate the most serious group rules. It is
related to exile and banishment, although shunning is based on social rather than physical isolation or separation. Silent treatmentNarcissistic parent | ||
Enmeshment
cabrón is a Spanish slang word, literally meaning "male goat,"
andd roughly equivalent to the English bastard, badass, dumb ass or
dude, depending on context.... sort of like a family or community
scapegoat. We may also consider:
A sacrificial lamb is a metaphorical reference to a person or animal sacrificed for the common good. The term is derived from the traditions of Abrahamic religion where a lamb is a highly valued possession. The black sheep in the family is also associated with shunning and as a scapegoat Binding of Isaac (Hebrew: עֲקֵידַת יִצְחַק ʿAqēḏaṯ Yīṣḥaq, in Hebrew also simply "the Binding", הָעֲקֵידָה hāʿAqēḏāh) Yoga is typically defined as “to yoke” as in to join two things together. In the western understanding of this it generally means joining mind and spirit or body, mind and spirit.Saturn Devouring His SonTransitive relationParent functionParent Functions And Their Graphs
A
nuclear family, elementary family or conjugal family is a family group
consisting of parents and their children. It is in contrast to a
single-parent family, the larger extended family, or a family with more
than two parents.
Nucleon is the collective term for protons and neutrons.
Nucleons are the particles found in the nucleus of atoms. ... Through a
beta decay, the weak force can turn one nucleon into another
nucleon—either protons to neutrons or neutrons to protons. Nucleons are
incredibly small, about 10-15 m, 10,000x smaller than an atom! What are nucleons made of? In
physics and chemistry, a nucleon refers to any subatomic particle found
in the nucleus of an atom. For instance, protons and neutrons are
nucleons, since they are in the nucleus of the atom. Nucleons are made
of quarks. HCC and MFA in Houston noted how the 'new world' was depicted as a 'garden of eden' from the Bible with artists as Church. Interactive whiteboardAlonzo Church's thesis (constructive mathematics)Turing machineComputable functionChurch–Turing thesisMatroidMatroid oracleCentral processing unitVirtual CPUsQuantum circuitExamples of vector spaces Lambda Calculus and Computation
PROSITE is a protein database.[1][2] It consists of entries describing the protein families, domains and functional sites as well as amino acid patterns and profiles in them. These are manually curated by a team of the Swiss Institute of Bioinformatics and tightly integrated into Swiss-Prot protein annotation. PROSITE was created in 1988 by Amos Bairoch, who directed the group for more than 20 years. Since July 2018, the director of PROSITE and Swiss-Prot is Alan Bridge. https://prosite.expasy.org/
The nitrogenous bases in DNA are adenine (A), guanine (G), thymine (T), and cytosine (C). The nitrogenous bases in RNA are the same, with one exception: adenine (A), guanine (G), uracil (U), and cytosine (C)
Finding nuclear localization signalsJohn Bradshaw (author)
‘Inner Child,’John Bradshaw's son
Brad IsaacsTV producer Compare and contrast with Evangelical
Rick Warren | ||
Thank God for reality... and the means to escape from it!It's All in Your Head (Negativland album)Religious war
According to the Encyclopedia of Wars, out of all 1,763 known/recorded historical conflicts, 123, or 6.98%, had religion as their primary cause.
Matthew White's The Great Big Book of Horrible Things gives religion as
the primary cause of 11 of the world's 100 deadliest atrocities.
War and religionSome
arguments a son may engage in with a father are perhaps best suited for
opera and other humanitarian art. Indeed, some topics can be maddening
if debated and argued. Even if they cry to an uncle over an argument one
has had with one's father in lieu of an expensive psychotherapist,
priest, guru or shaman. PanpsychismPhilosophy of mindArtificial consciousness | ||
Small Business Education and Entrepreneurial Development (SEED)
NIH Innovator Support
Experienced life science executives to help take your technology to the market
Trial Innovation Network
Quantum Machine Learning: a faster clustering algorithm on a quantum computer
Quantum spectral clustering
Iordanis Kerenidis and Jonas Landman
Phys. Rev. A 103, 042415 – Published 15 April 2021
Algebraic structure
Parallel Virtual Machine
Node (computer science)
Jeremiah was a performance artist...
The Conference of the Birds
The title is taken directly from the Qur’an, 27:16, where Sulayman (Solomon) and Dāwūd (David) are said to have been taught the language, or speech, of the birds (manṭiq al-ṭayr)... The hoopoe tells the birds that they have to cross seven valleys in order to reach the abode of Simorgh. These valleys are as follows:[3]
1. Valley of the Quest, where the Wayfarer begins by casting aside all dogma, belief, and unbelief.
2. Valley of Love, where reason is abandoned for the sake of love.
3. Valley of Knowledge, where worldly knowledge becomes utterly useless.
4. Valley of Detachment, where all desires and attachments to the world are given up. Here, what is assumed to be “reality” vanishes.
5. Valley of Unity, where the Wayfarer realizes that everything is connected and that the Beloved is beyond everything, including harmony, multiplicity, and eternity.
6. Valley of Wonderment, where, entranced by the beauty of the Beloved, the Wayfarer becomes perplexed and, steeped in awe, finds that he or she has never known or understood anything.
7. Valley of Poverty and Annihilation, where the self disappears into the universe and the Wayfarer becomes timeless, existing in both the past and the future.
Introducing Texans to Common Birds
Gabriel's Horn
a little bird told me
troubles with Twitter
Garuda
Garuda (Sanskrit: गरुड Garuḍa; Pāli: गरुळ Garuḷa), also Galon or Nan Belu in Burmese and Karura in Japanese, is a legendary bird or bird-like creature in Hindu, Buddhist and Jain faith.[1][3][4] He is variously the vehicle mount (vahana) of the Hindu god Vishnu, a dharma-protector and Astasena in Buddhism, and the Yaksha of the Jain Tirthankara Shantinatha.[3][4][5] The Brahminy kite is considered as the contemporary representation of Garuda.Harvey Birdman, Attorney at Law
Similar to angels, the Jinn Race or Demon Race are spiritual beings invisible to the naked human eye. In the Quran, it is stated that humans are created from the earth and jinn (demon) from smokeless fire in more than one instance.
Al-Jinn
Sabr
Seraphiel (Hebrew שׂרפיאל, meaning "Prince of the High Angelic Order") is the name of an angel in the apocryphal Book of Enoch.
Protector of Metatron, Seraphiel holds the highest rank of the Seraphim with the following directly below him, Jehoel. In some texts,[which?] he is referred to as the Angel of Silence. Eponymously named as chief of the Seraphim, one of several for whom this office is claimed, Seraphiel is one of eight judge angels and a prince of the Merkabah.[1] In 3 Enoch, Seraphiel is described as an enormous, brilliant angel as tall as the seven heavens with a face like the face of angels and a body like the body of eagles. He is beautiful like lightning and the light of the morning star. As chief of the seraphim, he is committed to their care and teaches them songs to sing for the glorification of God. In magical lore, Seraphiel is one of the rulers of Tuesday and also the planet Mercury. He is invoked from the North.[1][2]
Israfil could likely be his counterpart in Islam, one of the Archangels and an angel of music with a similar name of the same meaning.A demagogue /ˈdɛməɡɒɡ/ (from Greek δημαγωγός, a popular leader, a leader of a mob, from δῆμος, people, populace, the commons + ἀγωγός leading, leader)[1] or rabble-rouser[2][3] is a political leader in a democracy who gains popularity by arousing the common people against elites, especially through oratory that whips up the passions of crowds, appealing to emotion by scapegoating out-groups, exaggerating dangers to stoke fears, lying for emotional effect, or other rhetoric that tends to drown out reasoned deliberation and encourage fanatical popularity.[4] Demagogues overturn established norms of political conduct, or promise or threaten to do so.[5]
The Ant People of the Hopi
Bakhshali manuscript
Rock Art: Heritage Set in Stone
The Mystery of Chaco Canyon
Since the discovery of the prehistoric ruins of Chaco Canyon, New Mexico, their purpose has baffled archaeologists. The Mystery of Chaco Canyon challenges the long-held assumption that Chaco was a center of trade and offers an explanation of the site which reveals the brilliant astronomy of ancient pueblo people.
The one hour documentary, narrated by Robert Redford, premiered nationally on PBS on June 16, 2000.Not so fast...
Did China discover AMERICA? Ancient Chinese script carved into rocks may prove Asians lived in New World 3,300 years ago
- Author and researcher John Ruskamp claims to have found pictograms from the ancient Chinese Shang Dynasty etched into rocks in America
- The symbols are carved into rocks in New Mexico, California and Arizona
- He says the Chinese were exploring North America long before Europeans
- He claims the symbols give details of journeys and honour the Shang king
Petroglyphs, Pictographs, and a Geoglyph: Rock Art of the American Southwest
Ancient DNA confirms Native Americans’ deep roots in North and South America
By Lizzie WadeGenetic link between Asians and native Americans: evidence from HLA genes and haplotypes
Antiochus IV Epiphanes
Antiochus Epiphanes—The Bible’s Most Notoriously Forgotten Villain
Hanukah is the story of the Jewish revolt against Antiochus
A cult of personality, or cult of the leader,[1] arises when a country's regime – or, more rarely[citation needed], an individual – uses the techniques of mass media, propaganda, the big lie, spectacle, the arts, patriotism, and government-organized demonstrations and rallies to create an idealized, heroic, image of a leader, often through unquestioning flattery and praise. A cult of personality is similar to apotheosis, except that it is established by modern social engineering techniques, usually by the state or the party in one-party states and dominant-party states. It is often seen in totalitarian or authoritarian countries.
Gene Therapy for Cancer Treatment: Past, Present and Future
Hero's journey
Seven Factors of Awakening
In Buddhism, the Seven Factors of Awakening (Pali: satta bojjhaṅgā or satta sambojjhaṅgā; Skt.: sapta bodhyanga) are:
- Mindfulness (sati, Sanskrit smrti). To maintain awareness of reality (dharma).
- Investigation of the nature of reality (dhamma vicaya, Skt. dharmapravicaya).
- Energy (viriya, Skt. vīrya) also determination, effort
- Joy or rapture (pīti, Skt. prīti)
- Relaxation or tranquility (passaddhi, Skt. prashrabdhi) of both body and mind
- Concentration, (samādhi) a calm, one-pointed state of mind, or clear awareness
- Equanimity (upekkha, Skt. upekshā). To accept reality as-it-is (yathā-bhuta) without craving or aversion.
This evaluation of seven awakening factors is one of the "Seven Sets" of "Awakening-related states" (bodhipakkhiyadhamma).
The Pali word bojjhanga is a compound of bodhi ("awakening," "enlightenment") and anga ("factor").
Kleshas (Hinduism)
Kleśa (sanskrit क्लेश, also klesha ) is a term from Indian philosophy and yoga, meaning a "poison". The third śloka of the second chapter of Patañjali's Yoga sūtras explicitly identifies Five Poisons (Sanskrit: pañcakleśā):
- अविद्यास्मितारागद्वेषाभिनिवेशाः
पञ्च क्लेशाः॥३॥ - Avidyāsmitārāgadveṣābhiniveśāḥ pañca kleśāḥ[1]
Translated into English, these five (pañca) Kleśa-s or Afflictions (kleśāḥ) are:[1]
- Ignorance (in the form of a misapprehension about reality) (ávidyā),
- egoism (in the form of an erroneous identification of the Self with the intellect) (asmitā, ego; vanity, pride; assertion),
- attachment (rāga, coloring, tingeing, dyein: melodic mode, attachment to a sensory object: greed, sensuality, lust, desire),
- aversion (dveṣa, Dveṣa literally mean ‘that which causes repulsion, hatred or dislike), and
- fear of death (which is derived from clinging ignorantly to life) (abhiniveśāḥ).
The 24th sutra of the first chapter, Samadhi Pada, Patanjali describes a purusha free of kleshas
- शकभयणवऩाकाशमैयऩयाभृष्ट् ऩ रुषणवश ष ईश्वय् ॥ २४॥
- kleshakarmavipakashayairaparam
rishtah purushavishesh eeshvarah[1] - Isvara (God/the Supreme Ruler) is a special Purusa (Spirit), untouched by kleshas, or by karmas - the results of actions or desires.
Jali
Pancha Bhoota
The Five Elements
TAT TVAM ASI
Griot
Kleshas (Buddhism)
Jeremiah
Gut bacteria may 'talk' to the brain, mouse study suggests
...
The Jerry Lewis MDA Labor Day Telethon.
| MDA Labor Day Telethon | |
|---|---|
| Running time | 1,290 minutes (1966–2010) 360 minutes (2011) 180 minutes (2012) 120 minutes (2013–2014) |
University of Texas
Cellular and Biomolecular Engineering
Fiber (mathematics)
In mathematics, the term fiber (US English) or fibre (British English) can have two meanings, depending on the context:
- In naive set theory, the fiber of the element y in the set Y under a map f : X → Y is the inverse image of the singleton {y} under f.
- In algebraic geometry, the notion of a fiber of a morphism of schemes must be defined more carefully because, in general, not every point is closed.
Fibrifold a fibroblast with Cure CMD and the reticular fibers!
By David Vincent Bell HirschFiber (computer science)
In computer science, a fiber is a particularly lightweight thread of execution.
Like threads, fibers share address space. However, fibers use cooperative multitasking while threads use preemptive multitasking. Threads often depend on the kernel's thread scheduler to preempt a busy thread and resume another thread; fibers yield themselves to run another fiber while executing.
Beowulf, a hero of the Geats, comes to the aid of Hrothgar, the king of the Danes, whose mead hall in Heorot has been under attack by the monster Grendel.
Once there were skateboarders who got a cable television show. And on that show, they allowed themselves to be bitten by snakes, attacked by dogs, and subjected to all manner of olfactory terrors. And then they were gone. How did ‘Jackass’ succeed where so many other jackasses have failed?
Snake handling in religion
Name: Witiko
Tribal affiliation: Cree, Atikamekw
Alternate spellings: Wihtikiw, Wihtikow, Wihtiko, Wiihtiko, Wetiko, Uitiko, Wiitiko, Weetigo, Witiku, Witigo, Weetekow, Weeteego, Wee-tee-go,
Outikou, Outiko, Weediko, Wi'tiko, Weeghteko, Wehtigo, Wetigo, Wihtigo, Weh-ta-ko, Whit-Te-Co.
Witikowak is a plural form (also spelled wihtikowak or wihtikiwak.)
Pronunciation: Varies by dialect: usually wih-tih-kew or wih-tih-koh.
Type: Monster, ice cannibal
Related figures in other tribes: Windigo (Anishinabe),
Kee-wakw (Abenaki),
Chenoo (Mi'kmaq)
Consider the monster Grendel...
Joseph Campbell's Hero's Journey and
Poltergeist (computer programming)
CRISPR
CRISPR (/ˈkrɪspər/) (which is an acronym for clustered regularly interspaced short palindromic repeats)
Computer cluster
Quantum clustering
BioWoulf
Classes, Seminars & Walk-In Consults
Beowulf cluster
Debye
An adparticle is an atom, molecule, or cluster of atoms or molecules that lies on a crystal surface. The term is used in surface chemistry. The word is a contraction of "adsorbed particle". An adparticle that is a single atom may be referred to as an "adatom".
Strings are applied e.g. in Bioinformatics to describe DNA strands composed of nitrogenous bases.
Bioinformatics
Telomere
Telemetry
Telemetry is the in situ collection of measurements or other data at remote points and their automatic transmission to receiving equipment (telecommunication) for monitoring.[1] The word is derived from the Greek roots tele, "remote", and metron, "measure". Systems that need external instructions and data to operate require the counterpart of telemetry, telecommand.[2]
Although the term commonly refers to wireless data transfer mechanisms (e.g., using radio, ultrasonic, or infrared systems), it also encompasses data transferred over other media such as a telephone or computer network, optical link or other wired communications like power line carriers. Many modern telemetry systems take advantage of the low cost and ubiquity of GSM networks by using SMS to receive and transmit telemetry data.
A telemeter is a physical device used in telemetry. It consists of a sensor, a transmission path, and a display, recording, or control device. Electronic devices are widely used in telemetry and can be wireless or hard-wired, analog or digital. Other technologies are also possible, such as mechanical, hydraulic and optical.[3]
Telemetry may be commutated to allow the transmission of multiple data streams in a fixed frame.
Transposable element
A transposable element (TE, transposon, or jumping gene) is a DNA sequence that can change its position within a genome, sometimes creating or reversing mutations and altering the cell's genetic identity and genome size.
Transposons: The Jumping Genes
genomics
Scientists Catch Jumping Genes Rewiring Genomes
NMDA receptor
The N-methyl-D-aspartate receptor (also known as the NMDA receptor or NMDAR), is a glutamate receptor and ion channel found in neurons. The NMDA receptor is one of three types of ionotropic glutamate receptors, the other two being AMPA and kainate receptors. Depending on its subunit composition, its ligands are glutamate and glycine (or D-serine). However, the binding of the ligands is typically not sufficient to open the channel as it may be blocked by Mg2+ ions which are only removed when the neuron is sufficiently depolarized. Thus, the channel acts as a “coincidence detector” and only once both of these conditions are met, the channel opens and it allows positively charged ions (cations) to flow through the cell membrane.[2] The NMDA receptor is thought to be very important for controlling synaptic plasticity and mediating learning and memory functions.[3]
The NMDA receptor is ionotropic, meaning it is a protein which allows the passage of ions through the cell membrane.[4] The NMDA receptor is so named because the agonist molecule N-methyl-D-aspartate (NMDA) binds selectively to it, and not to other glutamate receptors. Activation of NMDA receptors results in the opening of the ion channel that is nonselective to cations, with a combined reversal potential near 0 mV. While the opening and closing of the ion channel is primarily gated by ligand binding, the current flow through the ion channel is voltage-dependent. Extracellular magnesium (Mg2+) and zinc (Zn2+) ions can bind to specific sites on the receptor, blocking the passage of other cations through the open ion channel. Depolarization of the cell dislodges and repels the Mg2+ and Zn2+ ions from the pore, thus allowing a voltage-dependent flow of sodium (Na+) and calcium (Ca2+) ions into the cell and potassium (K+) out of the cell.[5][6][7][8] Ca2+ flux through NMDA receptors in particular is thought to be critical in synaptic plasticity, a cellular mechanism for learning and memory, due to proteins which bind to and are activated by Ca2+ ions.
The activity of the NMDA receptor is affected by many psychoactive drugs such as phencyclidine (PCP), alcohol (ethanol) and dextromethorphan (DXM). The anaesthetic and analgesic effects of the drugs ketamine and nitrous oxide are partially due to their effects on NMDA receptor activity. However, overactivation of NMDAR increases the cytosolic concentrations of calcium and zinc, which significantly contributes to neural death, that is found to be prevented by cannabinoids, with requirement of a HINT1 protein to counteract the toxic effects of NMDAR-mediated NO production and zinc release, through activation of the CB1 receptor.[9] As well as preventing methamphetamine (Meth) induced neurotoxicity via inhibition of nitric oxide synthase (nNOS) expression and astrocyte activation, is seen to reduce methamphetamine induced brain damage through a CB1-dependent and independent mechanisms, respectively, and inhibition of methamphetamine induced astrogliosis is likely to occur through a CB2 receptor dependent mechanism for THC.[10] Since 1989, memantine has been recognized to be an uncompetitive antagonist of the NMDA receptor, entering the channel of the receptor after it has been activated and thereby blocking the flow of ions.[11][12][13]
What is NMDA?
Microsoft's Software is Malware
Nonfree (proprietary) software is very often malware (designed to mistreat the user). Nonfree software is controlled by its developers, which puts them in a position of power over the users; that is the basic injustice. The developers and manufacturers often exercise that power to the detriment of the users they ought to serve.
This typically takes the form of malicious functionalities.
Spybot Anti-Beacon
Root complex
Device Memory Map
Apotome (mathematics)
Northbridge (computing)
Intel Management Engine
Quantum logic gate
Square root of NOT gate (√NOT)
Nested radical
Arc is the new brand for Intel’s gaming GPUs
Tangential angle
Quantum algorithm
Intel’s Arc GPUs will compete with GeForce and Radeon in early 2022
"Alchemist" will be Intel's first serious dedicated gaming GPU.
Systems neuroscience
- Instrumentation
- Machine to Machine (M2M)
- MQ Telemetry Transport (MQTT)
- Portable telemetry
- Reconnaissance satellite, tapping of communications routing or switching centers (e.g., Echelon)
- Remote monitoring and control
- Remote sensing
- Remote Terminal Unit (RTU)
- SBMV Protocol
- SCADA
- Telecommand
- Telematics
- Wireless sensor network
Tejas, Tejās: 22 definitions
Involvement of the NMDA System in Learning and Memory
What God, Quantum Mechanics and Consciousness Have in Common
Theories that try to explain these big metaphysical mysteries fall short, making agnosticism the only sensible stance
3D Modeling Programs
A Specific Role of Hippocampal NMDA Receptors and Arc Protein in Rapid Encoding of Novel Environmental Representations and a More General Long-Term Consolidation Function
NMDA receptors, place cells and hippocampal spatial memory
Are our memories formed by an ancient virus?
Arc, a key protein in memory formation, looks and behaves like a retrovirus, moving RNA between cells in a virus-like capsid. Elissa Pastuzyn explains how this extraordinary protein ended up in our genomeMemory and the NMDA Receptors
Word (computer architecture)
What the heck is a time crystal, and why are physicists obsessed with them?
Some of today’s quantum physicists are tinkering with an esoteric
phase of matter that seems to disobey some of our laws of physics.
A step-by-step guide for creating advanced Python data visualizations with Seaborn / Matplotlib
Although there’re tons of great visualization tools in Python, Matplotlib + Seaborn still stands out for its capability to create and customize all sorts of plots.
A role for NMDA-receptor channels in working memory
Asynchronous release sites align with NMDA receptors in mouse hippocampal synapses
Gut check
Scientists discover a “mind-blowing” link between gut health and age reversal
“By restoring health in the microbiome we’re able to reverse age-related cognitive deficits,” scientists say about their new study in mice.
Hey, There's a Second Brain in Your Gut
Have you checked within your mathematical pair of pants as well?Prehistoric Viruses and the Function of the Brain
The exceedingly strange story of learning, memory and the “Arc” gene
Memory corruption
What Is an Economic Moat?
Meltdown (security vulnerability)
Networks of Small Sensors (Motes): Their Function and Applications
Heisenbug
in context ofExploiting memory corruption vulnerabilities on Android
Buffer overflow
Memory gene goes viral
NIH-funded research reveals novel method for transferring genetic material between neurons
Google wants to help improve memory safety in Linux kernel
How an Ancient Virus Spread the Ability to Remember
— Genetics may hold the key to human cognition
Remember remembering? - Davy Crockett
The GluN2A Subunit Regulates Neuronal NMDA receptor-Induced Microglia-Neuron Physical Interactions
NMDA receptors and memory encoding
Interaction of NMDA Receptor and Pacemaking Mechanisms in the Midbrain Dopaminergic Neuron
A Hebbian learning rule gives rise to mirror neurons and links them to control theoretic inverse models
Now nevermind and forget all that...
Structure of an Arc-ane virus-like capsid
What is a Perceptron?
Ark of the Covenant
Attention? Attention!
Keepers of the Lost Ark?
Christians in Ethiopia have long claimed to have the ark of the covenant. Our reporter investigated
Hebbian learning and predictive mirror neurons for actions, sensations and emotions
- Hebbian - Neocognitron, Brain-state-in-a-box[4]
- Gradient Descent - ADALINE, Hopfield Network, Recurrent Neural Network
- Competitive - Learning Vector Quantisation, Self-Organising Feature Map, Adaptive Resonance Theory
- Stochastic - Boltzmann Machine, Cauchy Machine (Cauchy process) (what the Devil Staircase!)
Brownian motor
Examples in nature
In biology, much of what we understand to be protein-based molecular motors may also in fact be Brownian motors. These molecular motors facilitate critical cellular processes in living organisms and, indeed, are fundamental to life itself.
Researchers have made significant advances in terms of examining these organic processes to gain insight into their inner workings. For example, molecular Brownian motors in the form of several different types of protein exist within humans. Two common biomolecular Brownian motors are ATP synthase, a rotary motor, and myosin II, a linear motor.[11] The motor protein ATP synthase produces rotational torque that facilitates the synthesis of ATP from Adenosine diphosphate (ADP) and inorganic phosphate (Pi) through the following overall reaction:
ADP + Pi + 3H+out ⇌ ATP + H2O + 3H+in
In contrast, the torque produced by myosin II is linear and is a basis for the process of muscle contraction.[11] Similar motor proteins include kinesin and dynein, which all convert chemical energy into mechanical work by the hydrolysis of ATP. Many motor proteins within human cells act as Brownian motors by producing directed motion on the nanoscale, and some common proteins of this type are illustrated by the following computer-generated images.
- Proteins acting as Brownian motors inside human cells
ATP Synthase
Brownian motion
MSTN gene
myostatinThe MSTN gene provides instructions for making a protein called myostatin. This protein is part of the transforming growth factor beta (TGFβ) superfamily, which is a group of proteins that help control the growth and development of tissues throughout the body. Myostatin is found almost exclusively in muscles used for movement (skeletal muscles), where it is active both before and after birth. This protein normally restrains muscle growth, ensuring that muscles do not grow too large. Myostatin has been studied extensively in mice, cows, and other animals, and it appears to have a similar function in humans.
Researchers are studying myostatin as a potential treatment for various muscular dystrophies that cause muscle weakness and wasting (atrophy).
Myostatin
Myostatin (also known as growth differentiation factor 8, abbreviated GDF8) is a myokine, a protein produced and released by myocytes that acts on muscle cells to inhibit muscle cell growth. In humans it is encoded by the MSTN gene.[6] Myostatin is a secreted growth differentiation factor that is a member of the TGF beta protein family.[7][8]
Animals either lacking myostatin or treated with substances that block the activity of myostatin have significantly more muscle mass. Furthermore, individuals who have mutations in both copies of the myostatin gene have significantly more muscle mass and are stronger than normal. There is hope that studies into myostatin may have therapeutic application in treating muscle wasting diseases such as muscular dystrophy.[9]
Dominance (genetics)
Dominance is not inherent to an allele or its traits (phenotype). It is a strictly relative effect between two alleles of a given gene of any function; one allele can be dominant over a second allele of the same gene, recessive to a third and co-dominant with a fourth. Additionally, one allele may be dominant for one trait but not others.
Dominance is a key concept in Mendelian inheritance and classical genetics. Letters and Punnett squares are used to demonstrate the principles of dominance in teaching, and the use of upper case letters for dominant alleles and lower case letters for recessive alleles is a widely followed convention. A classic example of dominance is the inheritance of seed shape in peas. Peas may be round, associated with allele R, or wrinkled, associated with allele r. In this case, three combinations of alleles (genotypes) are possible: RR, Rr, and rr. The RR (homozygous) individuals have round peas, and the rr (homozygous) individuals have wrinkled peas. In Rr (heterozygous) individuals, the R allele masks the presence of the r allele, so these individuals also have round peas. Thus, allele R is dominant over allele r, and allele r is recessive to allele R.
Allele
Allele frequency
ACTN3: More than Just a Gene for Speed
Craig Pickering1,2* and 
John Kiely1Actinin alpha 3
Philosophy of computer science
- Does the Church–Turing thesis capture the mathematical notion of an effective method in logic and mathematics?[4][5]
- What are the philosophical consequences of the P vs NP problem?
How Steven Weinberg Transformed Physics and Physicists
Steven Weinberg
Views on religion
Weinberg was an atheist.[46] He stated his views on religion in 1999:
Frederick Douglass told in his Narrative how his condition as a slave became worse when his master underwent a religious conversion that allowed him to justify slavery as the punishment of the children of Ham. Mark Twain described his mother as a genuinely good person, whose soft heart pitied even Satan, but who did not doubt the legitimacy of slavery, because in years of living in antebellum Missouri she had never heard any sermon opposing slavery, but only countless sermons preaching that slavery was God's will. With or without religion, good people can behave well and bad people can do evil; but for good people to do evil—that takes religion.[47][full citation needed]
Before he was an advocate of the Big Bang theory, Weinberg stated:[48]
The steady-state theory is philosophically the most attractive theory because it least resembles the account given in Genesis.
Wilson, Robert Anton - Masks of the Illuminati
Masks of the Illuminati by Robert Anton Wilson
Ham (son of Noah)
Ham, Hamlet, PiggyBac transposon system, Piggybacking (data transmissions) Piggybacking (marketing)
Hamlet: A Monologue
- Synopsis
- A video recording of a performance of theatre designer Robert Wilson’s performance-piece HAMLET: A MONOLOGUE. Wilson, working with Wolfgang Wiens’ text, performs Hamlet as a monologue in 15 scenes. He interprets not only Hamlet, but other characters too. Pulling props and costume pieces out of a trunk in the style of classic story theatre; Wilson also interprets Gertrude, Rosencrantz, Guildenstern and Ophelia.
By Heiner Müller
Gauge symmetry (mathematics)
Force field (chemistry)
PiggyBac transposon system
Piggybacking (data transmission)
In two-way communication, whenever a frame is received, the receiver waits and does not send the control frame (acknowledgement or ACK) back to the sender immediately.
The receiver waits until its network layer passes in the next data packet. The delayed acknowledgement is then attached to this outgoing data frame.
This technique of temporarily delaying the acknowledgement so that it can be hooked with next outgoing data frame is known as piggybacking.
Working (capital) Principle
Piggybacking data is a bit different from Sliding Protocol used in the OSI model. In the data frame itself, we incorporate one additional field for acknowledgment (called ACK).
Whenever party A wants to send data to party B, it will carry additional ACK information in the PUSH as well.
For example, if A has received 5 bytes from B, which sequence number starts from 12340 (through 12344), A will place "ACK 12345" as well in the current PUSH packet to inform B it has received the bytes up to sequence number 12344 and expects to see 12345 next time. (ACK number is the next sequence number of the data to be PUSHed by the other party.)
Three rules govern the piggybacking data transfer.
- If station A wants to send both data and an acknowledgment, it keeps both fields there.
- If station A wants to send the acknowledgment, after a short period of time to see whether a data frame needs to be sent, then decide whether send an ACK frame alone or attach a data frame with it.
- If station A wants to send just the data, then the previous acknowledgment field is sent along with the data. Station B simply ignores this duplicate ACK frame upon receiving.
Advantages and Disadvantages
Advantages : Improves the efficiency, better use of available channel bandwidth.[1] Disadvantages : The receiver can jam the service if it has nothing to send. This can be solved by enabling a counter (Receiver timeout) when a data frame is received. If the count ends and there is no data frame to send, the receiver will send an ACK control frame. The sender also adds a counter (Emitter timeout), if the counter ends without receiving confirmation, the sender assumes packet loss, and sends the frame again.
References
The Information Age was enabled by technology developed in the Digital Revolution, which was itself enabled by building on the developments of the Technological Revolution.
Transistors
Economics
Eventually, Information and communication technology (ICT)—i.e. computers, computerized machinery, fiber optics, communication satellites, the Internet, and other ICT tools—became a significant part of the world economy, as the development of microcomputers greatly changed many businesses and industries.[20][21] Nicholas Negroponte captured the essence of these changes in his 1995 book, Being Digital, in which he discusses the similarities and differences between products made of atoms and products made of bits.[22] In essence, a copy of a product made of bits can be made cheaply and quickly, then expediently shipped across the country or the world at very low cost.
Jobs and income distribution
The Information Age has affected the workforce in several ways, such as compelling workers to compete in a global job market. One of the most evident concerns is the replacement of human labor by computers that can do their jobs faster and more effectively, thus creating a situation in which individuals who perform tasks that can easily be automated are forced to find employment where their labor is not as disposable.[23] This especially creates issue for those in industrial cities, where solutions typically involve lowering working time, which is often highly resisted. Thus, individuals who lose their jobs may be pressed to move up into joining "mind workers" (e.g. engineers, doctors, lawyers, teachers, professors, scientists, executives, journalists, consultants), who are able to compete successfully in the world market and receive (relatively) high wages.[24]
Along with automation, jobs traditionally associated with the middle class (e.g. assembly line, data processing, management, and supervision) have also begun to disappear as result of outsourcing.[25] Unable to compete with those in developing countries, production and service workers in post-industrial (i.e. developed) societies either lose their jobs through outsourcing, accept wage cuts, or settle for low-skill, low-wage service jobs.[25] In the past, the economic fate of individuals would be tied to that of their nation's. For example, workers in the United States were once well paid in comparison to those in other countries. With the advent of the Information Age and improvements in communication, this is no longer the case, as workers must now compete in a global job market, whereby wages are less dependent on the success or failure of individual economies.[25]
In effectuating a globalized workforce, the internet has just as well allowed for increased opportunity in developing countries, making it possible for workers in such places to provide in-person services, therefore competing directly with their counterparts in other nations. This competitive advantage translates into increased opportunities and higher wages.[26]
Automation, productivity, and job gain
The Information Age has affected the workforce in that automation and computerisation have resulted in higher productivity coupled with net job loss in manufacturing. In the United States, for example, from January 1972 to August 2010, the number of people employed in manufacturing jobs fell from 17,500,000 to 11,500,000 while manufacturing value rose 270%.[27]
Although it initially appeared that job loss in the industrial sector might be partially offset by the rapid growth of jobs in information technology, the recession of March 2001 foreshadowed a sharp drop in the number of jobs in the sector. This pattern of decrease in jobs would continue until 2003,[28] and data has shown that, overall, technology creates more jobs than it destroys even in the short run.[29]
Information-intensive industry
Industry has become more information-intensive while less labor- and capital-intensive. This has left important implications for the workforce, as workers have become increasingly productive as the value of their labor decreases. For the system of capitalism itself, not only is the value of labor decreased, the value of capital is also diminished.
In the classical model, investments in human and financial capital are important predictors of the performance of a new venture.[30] However, as demonstrated by Mark Zuckerberg and Facebook, it now seems possible for a group of relatively inexperienced people with limited capital to succeed on a large scale.[31]
Gene duplication
Tandem exon duplication is defined as duplication of exons within the same gene to give rise to the subsequent exon. A complete exon analysis of all genes in Homo sapiens, Drosophila melanogaster, and Caenorhabditis elegans has shown 12,291 instances of tandem duplication in exons in human, fly, and worm. Analysis of the intronic region has produced further 4,660 unidentified duplicated exons referred to as unannotated exons. 1,578 of these unannotated exons contained stop codons thus not considered potential exons. 35.1% of the unannotated exons were found in the EST sequence thus confirming the potential of the presence of these exons in protein transcripts.[1]
Insertion of the IL1RAPL1 gene into the duplication junction of the dystrophin gene
Transcriptional Behavior of DMD Gene Duplications in DMD/BMD Males F. Gualandi1, M.Neri 1, M. Bovolenta1, E. Martoni1, P. Rimessi1, S. Fini1, P. Spitali1, M. Fabris1, M. Pane2, C. Angelini3, M. Mora4, L. Morandi4, T. Mongini 5, E. Bertini6, E. Ricci7, G. Vattemi8, E. Mercuri9, L. Merlini1, and A. Ferlini
Tandem duplications of two separate fragments of the dystrophin gene in a patient with Duchenne muscular dystrophy
- Zhujun Zhang,
- Yasuhiro Takeshima,
- Hiroyuki Awano,
- Atsushi Nishiyama,
- Yo Okizuka,
- Mariko Yagi &
- Masafumi Matsuo
String (computer science)
String theory
Pappy, look at that... DNA strands are composed of Nitrogenous bases.Stem CellsGAP-Seq: a method for identification of DNA palindromes
Structure-based combinatorial protein engineering
A reference catalog of DNA palindromes in the human genome and their variations in 1000 Genomes
Duchenne Muscular Dystrophy (DMD)
What is Duchenne muscular dystrophy?
COL4A6 collagen type IV alpha 6 chain [ Homo sapiens (human) ]
Wellstone Muscular Dystrophy Research Network
Established as part of the NIH enhancement and intensification of muscular dystrophy research associated with the MD-CARE Act, the centers are supported by five-year, renewable grants.Myoediting Core/Duchenne Skipper Database
Nanozymes
Nanozyme: new horizons for responsive biomedical applications
Scleroprotein
Ribozyme
Membrane protein
Proteasome
Site-Selective RNA Splicing Nanozyme: Dnazyme and RTCB Conjugates on a Gold Nanoparticle
Hypersurface
Born–Oppenheimer approximation with correct symmetry
Franck–Condon principle
Lattice Boltzmann methods
Fokker–Planck equation
Boltzmann equation
Chemical equilibrium
BBGKY hierarchy
Chaitanya Chintaluri1,2,†, Marta Kowalska1,†, Władysław Średniawa1,3, Michał
Czerwiński1, Jakub M. Dzik1, Joanna Jędrzejewska-Szmek1, Daniel K. Wójcik1,*
Installation
Homology (mathematics)
Topology
How Mathematicians Use Homology
Recursion
Artificial intelligence
Palindrome string related questions
Computer algebra
Computer algebra system
List of computer algebra systems
Object (computer science)
What is a grammar?
Welcome to Palindrome
FokI
Nuclease
Gene therapy
Transcription activator-like effector nuclease
Zwitterion
How To Create a Twitter App and API Interface Via Python
Dynamical mean-field theory
Mean-field theory
Dimer (chemistry)
Protein dimer
Reagent
Substrate (chemistry)
Scalar field
Hessian matrix
Caspar Wessel
Nicholas A. Scoville∗, Diana White
Library (computing)
Spherical trigonometry
Transfection
Use the Schwartz Luke 11:11 in a Priestley space
Schwarz triangle
Use the Schwartz
Glueball
Penrose tiling
Riemann sphere
Hopf fibration
Fiber bundle
Hopf fibration Chaos Theory Total Order Free Action
By David Vincent Bell HirschStructural genomics
Dera Tompkins
Dera Tompkins is a Biomedical Librarian at the NIH Library at the National Institutes of Health. She previously served as a Medical Librarian at the Neuroscience Reseach Center, NIMH.
Library (computing)
Biowulf is intended to run code programmed by our users as well as commercial and open-source codes that may need to be built for our platform(s) if they do not come in a useable binary format. Accordingly, we host a number of compilers and build environments to suit the needs of developers and individuals that need to build projects from source.
This page provides information specific to the Biowulf development
environment as well as a rough overview of the various compilers,
libraries and programs used on our system. The linked documentation on
specific packages and programs will usually need to be consulted for any
useful understanding of them.
Library Workspaces
Data Analysis, Processing, and Visualization Tools
What's Available at the NIH Library
Office of Computer and Communications Systems
OCCS Mission
The Office of Computer and Communications Systems (OCCS) provides efficient, cost-effective computing and networking services, technical advice, and collaboration in informational sciences in support of the research and management programs offered through NLM.
OCCS develops and provides the NLM backbone computer networking facilities, and supports, guides, and assists other NLM components in local area networking. The Division provides professional programming services and computational and data processing facilities to meet NLM program needs; operates and maintains the NLM Computer Center; designs and develops software; and provides extensive customer support, training courses and seminars, and documentation for computer and network users.
OCCS helps to coordinate, integrate, and standardize the vast array of computer services available throughout all of the organizations comprising NLM. The Division also serves as a technological resource for other parts of the National Library of Medicine (NLM) and for other Federal organizations with biomedical, statistical, and administrative computing needs.
The Division promotes the application of High Performance Computing and Communication to biomedical problems, including image processing.
The OCCS staff develops computer-based systems for information retrieval applications, conducts computer science and engineering research and development, and consults and collaborates in the area of advanced electronic office automation facilities. They support software systems to perform these services, and conduct research and evaluations for best fit solutions to information access needs.
Autosomal DNA statistics
Gene family
Eagle's minimal essential medium
Molecular switch
Molecular biology
Molecular geometry
Molecular Psychiatry
Industrial and organizational psychology
Job scheduler
Schooliosis, a pun on "school" and "scoliosis", is a term for a type of medical misdiagnosis. The word was coined by Petr Skrabanek and James McCormick.[1]
The authors asserted that there is some degree of overdiagnosis of scoliosis in school, which causes ethical, social, and economic damage to the welfare of children.[2] Such overdiagnosis is called "schooliosis" by some academics. Schooliosis is a type of disease mongering.[3]
Preventive medical screening in school or college may lead to an incorrect diagnosis of scoliosis that triggers a series of unnecessary medical interventions on adolescents. There can be diagnostic and therapeutic cascades involving several specialists, which can end with iatrogenic damage to a healthy child with a normal back. The risks are unnecessary overexposure to X-rays (repeated diagnostic X-rays), rehabilitation techniques with side effects (traction), stigmatizing orthopaedic treatment (braces for back injury) and costs in time, travel, etc.[4]
The term has also been used in a non-medical sense for students' inability to imagine themselves as graduates.
Disease mongering
Selling sickness: the pharmaceutical industry and disease mongering
Knock (French title: Knock ou le Triomphe de la médecine) is a 1923 French satirical play about hypochondria, written by Jules Romains. It was performed for the first time at the Théâtre des Champs-Élysées in Paris on 15 December 1923 in a production by Louis Jouvet.
The ambitious Dr. Knock arrives in a rural village, Saint-Maurice, to step into Dr. Parpalaid's footsteps as the local physician. Unfortunately, the villagers are all in good health, which makes Knock realize that he has been duped by Parpalaid. He therefore decides to make everybody believe they are actually far sicker then they actually are...
take (something) on faith
Orchestration (computing)
See also
Remembering the Perez Orchestra
Emergence
In philosophy, systems theory, science, and art, emergence occurs when an entity is observed to have properties its parts do not have on their own, properties or behaviors which emerge only when the parts interact in a wider whole.
Emergence plays a central role in theories of integrative levels and of complex systems. For instance, the phenomenon of life as studied in biology is an emergent property of chemistry, and psychological phenomena emerge from the neurobiological phenomena of living things.
In philosophy, theories that emphasize emergent properties have been called emergentism.[1]
Luciferin
Optogenetics
Optogenetics is a biological technique that involves the use of light to control neurons that have been genetically modified to express light-sensitive ion channels. As such, optogenetics is a neuromodulation method that uses a combination of techniques from optics and genetics to control the activities of individual neurons in living tissue — even within freely-moving animals.[1] In some usages, optogenetics also refers to optical monitoring of neuronal activity[1] or control of other biochemical pathways in non-neuronal cells (see "Cellular biology/cell signaling pathways" section below),[2] although these research activities preceded the use of light-sensitive ion channels in neurons.[3][4] As optogenetics is used by some authors to refer to only optical control of the activity of genetically defined neurons and not these additional research approaches,[5][6][7] the term optogenetics is an example of polysemy.
Neuronal control is achieved using optogenetic actuators like channelrhodopsin, halorhodopsin, and archaerhodopsin, while optical recording of neuronal activities can be made with the help of optogenetic sensors for calcium (GCaMPs), vesicular release (synapto-pHluorin), neurotransmitters (GluSnFRs), or membrane voltage (Quasars, Accelerated Sensor of Action Potentials, Archons).[8][9] Control (or recording) of activity is restricted to genetically defined neurons and performed in a spatiotemporal-specific manner by light.
In 2010, optogenetics was chosen as the "Method of the Year" across all fields of science and engineering by the interdisciplinary research journal Nature Methods.[10] At the same time, optogenetics was highlighted in the article on "Breakthroughs of the Decade" in the academic research journal Science.[11][12][7]
- a person who is from 80 to 89 years old.
- a disease in which the small intestine is hypersensitive to gluten, leading to difficulty in digesting food.
Gut flora
Gut flora or gut microbiota are the microorganisms including bacteria, archaea and fungi that live in the digestive tracts of humans[1] and other animals including insects. The gastrointestinal metagenome is the aggregate of all the genomes of gut microbiota.[2][3] The gut is the main location of human microbiota.[4]
Understanding Luminal Microorganisms and their Potential Effectiveness in Treating Intestinal Inflammation
Interaction Between Resident Luminal Bacteria and the Host: Can a Healthy Relationship Turn Sour?
Haller, Dirk; Jobin, Christian*
-
Normal luminal bacteria, especially Bacteroides species, mediate chronic colitis, gastritis, and arthritis in HLA-B27/human beta2 microglobulin transgenic rats.
- How your belly could heal your brain
-
In Mexican cuisine, Menudo, also known as pancita ([little] gut or [little] stomach, from Spanish: Panza; "Gut/Stomach") or mole de panza ("stomach sauce"), is a traditional Mexican soup, made with cow's stomach (tripe) in broth with a red chili pepper base. It shares a name with a stew from the Philippines made with pork and pork liver.
Hominy, lime, onions, and oregano are used to season the broth
Gut Microbe to Brain Signaling: What Happens in Vagus…
-
Vagus Nerve as Modulator of the Brain–Gut Axis in Psychiatric and Inflammatory Disorders
- 1Division of Molecular Psychiatry, Translational Research Center, University Hospital of Psychiatry, University of Bern, Bern, Switzerland
- 2Department of Gastroenterology and Hepatology, University Hospital Zurich, Zurich, Switzerland
-
A key role of the subdiaphragmatic vagus nerve in the depression-like phenotype and abnormal composition of gut microbiota in mice after lipopolysaccharide administration
- Jiancheng Zhang,
- Li Ma,
- Lijia Chang,
- Yaoyu Pu,
- Youge Qu &
- Kenji Hashimoto
Sigrid Breit1†,
Gregor HaslerDepression on the menu?
Liposuction
is notLipopolysaccharide
I mean, why would you study depression in mice after liposuction?Chapter 23 - The Role of Endogenous Luminal Bacteria and Bacterial Products in the Pathogenesis of Experimental Enterocolitis and Systemic Inflammation
R.Balfour SartorEnthalpy
Relationship to heat
Concentration
Mole ratio
Empathy
Mole (espionage)
Molar mass distribution
Enthalpy Changes in Reactions
Molar heat capacity
Car–Parrinello molecular dynamics
Conformational entropy
Parallel programming model
Application programming interface key
Domain Name System
The Domain Name System (DNS) is a hierarchical and decentralized naming system for computers, services, or other resources connected to the Internet or a private network. It associates various information with domain names assigned to each of the participating entities. Most prominently, it translates more readily memorized domain names to the numerical IP addresses needed for locating and identifying computer services and devices with the underlying network protocols. By providing a worldwide, distributed directory service, the Domain Name System has been an essential component of the functionality of the Internet since 1985.- Physical (e.g. cable, RJ45)
- Data Link (e.g. MAC, switches)
- Network (e.g. IP, routers)
- Transport (e.g. TCP, UDP, port numbers)
- Session (e.g. Syn/Ack)
- Presentation (e.g. encryption, ASCII, PNG, MIDI)
- Application (e.g. SNMP, HTTP, FTP)
Schubert calculus
The intersection theory of these cells, which can be seen as the product structure in the cohomology ring of the Grassmannian of associated cohomology classes, in principle allows the prediction of the cases where intersections of cells results in a finite set of points, which are potentially concrete answers to enumerative questions. A supporting theoretical result is that the Schubert cells (or rather, their classes) span the whole cohomology ring.
In detailed calculations the combinatorial aspects enter as soon as the cells have to be indexed. Lifted from the Grassmannian, which is a homogeneous space, to the general linear group that acts on it, similar questions are involved in the Bruhat decomposition and classification of parabolic subgroups (by block matrix).
Putting Schubert's system on a rigorous footing is Hilbert's fifteenth problem.
Schubert variety
Tutorial on
Schubert Varieties and Schubert Calculus
Sara Billey
In graph theory and computer science, an adjacency matrix is a square matrix used to represent a finite graph. The elements of the matrix indicate whether pairs of vertices are adjacent or not in the graph.
In the special case of a finite simple graph, the adjacency matrix is a (0,1)-matrix with zeros on its diagonal. If the graph is undirected, the adjacency matrix is symmetric. The relationship between a graph and the eigenvalues and eigenvectors of its adjacency matrix is studied in spectral graph theory.
The adjacency matrix should be distinguished from the incidence matrix for a graph, a different matrix representation whose elements indicate whether vertex–edge pairs are incident or not, and degree matrix which contains information about the degree of each vertex.
Matrix multiplication
A fundamental example is the multivariate chain rule. A basic principle in mathematics is that if a problem is hard, you should try to linearize it so that you can reduce as much of it as possible to linear algebra. Often this means replacing a function with a linear approximation (its Jacobian), and then composition of functions becomes multiplication of Jacobians. But of course there are many other ways to reduce a problem to linear algebra.
More generally, one can interpret matrices as representing (possibly weighted) edges in a directed graph which may or may not have loops, and products of matrices as specifying the total number (or total weight) of all the walks with a given structure, between pairs of vertices.
General relativity also makes use of tensors, which are a generalization of the sorts of objects which row-vectors, column-vectors, and matrices all are. Very roughly speaking, row- and column-vectors are 'one dimensional' tensors, having only one index for its coefficients, and matrices are 'two dimensional' tensors, having two indices for its coefficients, of two different 'kinds' representing rows and columns — input and output, if you prefer. Tensors allow three or more indices, and to allow more than one index to have the same 'kind'.
Transfer-matrix method
- Packet analyzer – a computer program or piece of computer hardware that can intercept and log traffic that passes over a digital network
- Comparison of packet analyzers
Qubit
Wolfgang Pauli, Carl Jung, and the Acausal Connecting Principle: A Case Study in Transdisciplinarity
Atom, Archetype, and the Invention of Synchronicity: How Iconic Psychiatrist Carl Jung and Nobel-WinningPhysicist Wolfgang Pauli Bridged Mind and Matter
Two of humanity’s greatest minds explore the parallels between spacetime and the psyche, the atomic nucleus and the self.
Quantum jump method
barycentric
Computes the location of a point in a simplex in barycentric coordinates (aka areal coordinates).
Usage
Install using npm:
npm install barycentric
And then use as follows:
var barycentric = require("barycentric") console.log(barycentric([[0,0], [0,1], [1,0]], [0.5, 0.5])) //Prints: // // [0, 0.5, 0.5] //
Credits
(c) 2013 Mikola Lysenko. MIT License
Information entropy is the average rate at which information is produced by a stochastic source of data.
Perform Weighted Random with JavaScript
Gell-Mann matrices
The Gell-Mann matrices, developed by Murray Gell-Mann, are a set of eight linearly independent 3×3 traceless Hermitian matrices used in the study of the strong interaction in particle physics. They span the Lie algebra of the SU(3) group in the defining representation.Low-rank approximation
In mathematics, low-rank approximation is a minimization problem, in which the cost function measures the fit between a given matrix (the data) and an approximating matrix (the optimization variable), subject to a constraint that the approximating matrix has reduced rank. The problem is used for mathematical modeling and data compression. The rank constraint is related to a constraint on the complexity of a model that fits the data. In applications, often there are other constraints on the approximating matrix apart from the rank constraint, e.g., non-negativity and Hankel structure.Math is a built-in object that has properties and methods for mathematical constants and functions. Not a function object. Comparison of cluster software
List of cluster management software
Kubernetes
OpenMP
MongoDB is a general purpose, document-based, distributed database built for modern application developers and for the cloud era. No database is more productive to use.
Parallel Processing and Multiprocessing in Python
- Open the command prompt. Follow the menu path Start > Programs > Accessories > Command Prompt.
- Type: java -version and press Enter on your keyboard. Result: A message similar to the following indicates that Java is installed and you are ready to use MITSIS via the Java Runtime Environment.
Java is supported on Windows, OS X and Linux. It is not supported in iOS or Chrome OS. Java is very much involved in Android, but not in a way that is visible to end users.
https://javatester.org/
Graph database
In computing, a graph database (GDB) is a database that uses graph structures for semantic queries with nodes, edges, and properties to represent and store data. A key concept of the system is the graph (or edge or relationship). The graph relates the data items in the store to a collection of nodes and edges, the edges representing the relationships between the nodes. The relationships allow data in the store to be linked together directly and, in many cases, retrieved with one operation. Graph databases hold the relationships between data as a priority. Querying relationships within a graph database is fast because they are perpetually stored within the database itself. Relationships can be intuitively visualized using graph databases, making them useful for heavily inter-connected data.
Graph databases are part of the NoSQL databases created to address the limitations of the existing relational databases. While the graph model explicitly lays out the dependencies between nodes of data, the relational model and other NoSQL database models link the data by implicit connections. Graph databases, by design, allow simple and fast retrieval[citation needed] of complex hierarchical structures that are difficult to model[according to whom?] in relational systems. Graph databases are similar to 1970s network model databases in that both represent general graphs, but network-model databases operate at a lower level of abstraction[3] and lack easy traversal over a chain of edges.
Pipeline (computing)
palindrome algorithm javascript
Longest palindromic substring
casefold() # reverse the string rev_str = reversed(my_str) # check if the string is equal to its reverse if list(my_str) == list(rev_str): print("The string is a palindrome.") else: print("The string is not a palindrome.") The string is a palindrome.
By David Vincent Bell Hirsch
Muscular dystrophy in a dish: engineered human skeletal muscle mimetics for disease modeling and drug discovery
1,3,4-
Minority Colleges and Universities Grant Competition
-
Deadline: Applications must be submitted to Grants.gov no later than August 16th, 2021 at 11:59 PM EST
FDA Approves Targeted Treatment for Rare Duchenne Muscular Dystrophy Mutation
February 25, 2021The Code Breaker
The Code Breaker: Jennifer Doudna, Gene Editing, and the Future of the Human Race is a non-fiction book authored by American historian and journalist Walter Isaacson. Published in March 2021 by Simon & Schuster, it is a biography of Jennifer Doudna, the winner of the 2020 Nobel Prize in Chemistry for her work on the CRISPR system of gene editing.[1]
The book debuted at number one on The New York Times nonfiction best-seller list for the week ending March 13, 2021.[2]
Software Modules on the Terra Cluster
Amino acid conformational preferences and solvation of polar backbone atoms in peptides and proteins
The Sword in the Stone
Uther Pendragon
Uther Pendragon (/ˈjuːθər pɛnˈdræɡən, ˈuːθər/;[1] Welsh: Uthyr Pendragon, Uthyr Bendragon), also known as King Uther, is a legendary king of sub-Roman Britain and the father of King Arthur. A few minor references to Uther appear in Old Welsh poems, but his biography was first written down by Geoffrey of Monmouth in his Historia Regum Britanniae (History of the Kings of Britain), and Geoffrey's account of the character was used in most later versions. He is a fairly ambiguous individual throughout the literature, but is described as a strong king and a defender of his people.Background
Vijaya is the trident of Shiva used for total destruction or "Pralaya".
Legend
As per original Valmiki Ramayana [contested: no reference of this narration located in valmiki ramayan], two bows were created by God Devendra of equal capacity which were given to Rudra and Vishnu and requested them to fight with each other to know who is the powerful one. However just before the start of the war an Aakashvani said that the war will lead to total destruction and hence the war was stopped. On hearing Aakashvani, Rudra threw his Dhanush which fell on earth to be later known as "Shiva dhanush". It was later found by King Devaratha, the ancestor of King Janaka. It is mentioned in the Hindu epic Ramayana, when its hero Rama (another avatar of Vishnu) breaks it to marry Janaka's daughter as his wife.
Vishwakarma crafted two divine bows. He gave Sharanga to Lord Vishnu and Pinaka to Lord Shiva. King Janaka of Mithila had a daughter named Sita. In earlier part of her life, Sita while playing with her sisters had unknowingly lifted the table over which the bow had been placed; which was something no one in the kingdom could do. This incident was however observed by Janaka and he decided to make this incident as the backdrop for Sita's swayamvara.
Later, Janaka had announced that whosoever wanted to marry Sita had to lift the divine bow and string it. The bow was broken by Ayodhya's prince Rama when he attempted to string the bow, during the swayamvara of Sita, thereby winning the princess's hand in marriage. After the marriage when his father Dasharatha was returning to Ayodhya with Rama, Parashurama obstructed their path and challenged Rama for breaking his guru Shiva's bow. Rama extolled the sage. After that Dasharatha prayed to the sage to forgive him but Parashurama remained enraged and brought out Vishnu's bow. He then asked Rama to string the bow and fight a duel with him. Rama snatches the bow of Vishnu, strings it, places an arrow and points it straight at the challenger's heart. Rama then asks Parashurama what he will give as a target to the arrow. At this point, Parashurama feels himself devoid of his mystical energy. He realizes that Rama is the avatar of Vishnu.
One day, Rama was with his dear brother Lakshmana and his guru Viswamitra, when they all wandered into Mithila, the kingdom of King Janaka. Sita was King Janaka’s only daughter who was to be wed to the man who could bend Shiva’s bow. Many strong warriors came to attempt to bend Shiva’s bow, but no one succeeded of course! Rama easily took the bow and did not only bend it, but snapped it into many pieces
Fisher King
In Arthurian legend, the Fisher King (French: Roi pêcheur, Welsh: Brenin Pysgotwr), also known as the Wounded King or Maimed King (Roi blessé, in Old French Roi Méhaigié, Welsh: Brenin Clwyfedig), is the last in a long bloodline charged with keeping the Holy Grail. Versions of the original story vary widely, but he is always wounded in the legs or groin and incapable of standing. All he is able to do is fish in a small boat on the river near his castle, Corbenic, and wait for some noble who might be able to heal him by asking a certain question. In later versions, knights travel from many lands to try to heal the Fisher King, but only the chosen can accomplish the feat. This is achieved by Percival alone in the earlier stories; he is joined by Galahad and Bors in the later ones.Similarities:
Zeus, the King of the Greek Gods can fairly be compared to Indra, the Rig-Vedic King of Hindu Gods. Both these deities had control over weather and had thunderbolts as their weapons. They both had kingly chariots. Like the dwelling place of Zeus and other Olympian Gods, Mount Olympus, the dwelling place of the Hindu Gods was in Swarga located high above in the sky on Mount Meru.
Thor was the God of thunder.
Baal was considered as god of Storm and had various weapons including the Thunder Bolt.
Dissimilarities:
Indra's reputation is the king of the Devas. He rides on a white elephant Iravata.
Zeus, the final and Supreme God of the Greek mythology.
Thor was Son of Odin Chief God. He drove around clouds by a chariot driven by two Goats. Thor's weapon was a hammer Mjolnir which produced lightning and thunder.
Odin, the supreme Norse God went around on a eight legged horse.
See also
Chogyal
The Chogyal ("Dharma Kings", Tibetan: ཆོས་རྒྱལ, Wylie: chos rgyal, Sanskrit: धर्मराज) were the monarchs of the former kingdoms of Sikkim and Ladakh in present-day India, which were ruled by separate branches of the Namgyal dynasty. The Chogyal was the absolute monarch of Sikkim from 1642 to 1975, when the monarchy was abolished and its people voted in a referendum to make Sikkim the 22nd state of India.[1][2]
Live by the sword, die by the sword
Competent man
Finding Bugs in Quantum Programs
Yipeng Huang, Margaret Martonosi
Princeton University
Gabriel's Horn: or Torricelli's trumpet: A simple object with finite volume but infinite surface area. Also, the Mandelbrot set and various other fractals are covered by a finite area, but have an infinite perimeter (in fact, there are no two distinct points on the boundary of the Mandelbrot set that can be reached from one another by moving a finite distance along that boundary, which also implies that in a sense you go no further if you walk "the wrong way" around the set to reach a nearby point).
- Bohr bug: /bohr buhg/, n.
[from quantum physics] A repeatable bug; one that manifests reliably under a possibly unknown but well-defined set of conditions. Antonym of heisenbug; see also mandelbug, schroedinbug.
-
Steve Martin as the
Jerk (physics), "idiot physicists", Color Charge:
Color charge
Color charge is a property of quarks and gluons that is related to the particles' strong interactions in the theory of quantum chromodynamics (QCD).
The "color charge" of quarks and gluons is completely unrelated to the everyday meaning of color. The term color and the labels red, green, and blue became popular simply because of the loose analogy to the primary colors. Richard Feynman referred to his colleagues as "idiot physicists" for choosing the confusing name.
quantum jump from Frog Texas for Liberty Lunch, hold the octonions
How the Bits of Quantum Gravity Can Buzz
Pharisee and the Publican
A scalar or scalar quantity in physics is a physical quantity that can be described by a single element of a number field such as a real number, often accompanied by units of measurement. A scalar is usually said to be a physical quantity that only has magnitude, possibly a sign, and no other characteristics
Scale invariance
In it's Scalar form Coulomb's law is identical to Newton's law of Gravity:
Coulomb's law
Newton's law of universal gravitation
Electric field
Perlin noise
Fractal structure in the scalar λ(φ2−1)2 theory
Fracton
condensed matter physics
The ‘Weirdest’ Matter, Made of Partial Particles, Defies Description
Angular momentum coupling
John Clive Ward "Ward Identity"
Quantum field theory
Quantum entanglement
Entanglement distillation
entangler (Java Script)
Oploggery
Separable state
The Russell Saunders Coupling Scheme
Coupling of Angular Momentum and Spectroscopic Term Symbols
Fracton-Elasticity Duality
Vortices as fractons
Darshil Doshi 1 ✉& Andrey Gromov
Vortex
Toroid
Quaternionic Hopf fibrations
Excited state
Spin glass
In condensed matter physics, a spin glass is a model of a certain type of magnet.
Spin ice
Gravitational field
Sensor node
Chitosan
Chitin
Sensor node Improvements on the protein–dipole Langevin–dipole model
QM/MM
Austin,TX Programmers Austin Python programmer meetup
Pauli matrices
Gell-Mann matrices
Exploring chemical space: Can AI take us where no human has gone before?
Del
Landauer Theory, Inelastic Scattering and Electron Transport in Molecular Wires
Partition function (statistical mechanics)
Solvent model
In computational chemistry, a solvent model is a computational method that accounts for the behavior of solvated condensed phases.Immunofluorescence
Reaction Path
Reaction coordinate
Following the Intrinsic Reaction Coordinate
Transition state
How Bell’s Theorem Proved ‘Spooky Action at a Distance’ Is Real
System partition and boot partition
Data cluster
Approaches for calculating solvation free energies and enthalpies demonstrated with an update of the FreeSolv database
Molecular Hamiltonian
Hamiltonian Monte Carlo
Hamiltonian vector field
Hamiltonian field theory
Gauge theory
RNAstructure: software for RNA secondary structure prediction and analysis
Cyclic enzyme system
A cyclic enzyme system is a theoretical system of two enzymes sharing a single substrate or cofactor, also referred to as a biochemical switching device.[1] It has been used as a biochemical implementation of a simple computational device, acting as a chemical diode.[2]See also
Computational gene
Computational genes: a tool for molecular diagnosis and therapy of aberrant mutational phenotype
1 Gong Zhang,2 Zoya Ignatova,2 and Karl-Heinz Zimmermann1 Computational Approaches to Biochemical Reactivity
Methyltransferase
DNA methyltransferase
Thrombin
Potential energy surface
Empirical distribution function
Free energy perturbation
Chemical kinetics
Enzyme catalysis
Web-based design and analysis tools for CRISPR base editing
Human induced pluripotent stem cell models for the study and treatment of Duchenne and Becker muscular dystrophies
Fathema Uddin
Charles M. Rudin
Triparna Sen
COL4A6 collagen type IV alpha 6 chain [ Homo sapiens (human) ]
molecular biology
DNA Has Four Bases. Some Viruses Swap in a Fifth.
Pathophysiological Mechanisms of Sarcopenia in Aging and in Muscular Dystrophy
Exercise Mimetics: Impact on Health and Performance
Weiwei Fan1and Ronald M. Evans
Mandukasana
Stretching and hoping like a frog with Kermit the Frog is aFilm treatment
Frog, Texas
Frog is an unincorporated community in Kaufman County, located in the U.S. state of Texas.
Electroporation
Electroporation, or electropermeabilization, is a microbiology technique in which an electrical field is applied to cells in order to increase the permeability of the cell membrane, allowing chemicals, drugs, or DNA to be introduced into the cell (also called electrotransfer).[2][3] In microbiology, the process of electroporation is often used to transform bacteria, yeast, or plant protoplasts by introducing new coding DNA. If bacteria and plasmids are mixed together, the plasmids can be transferred into the bacteria after electroporation, though depending on what is being transferred cell-penetrating peptides or CellSqueeze could also be used. Electroporation works by passing thousands of volts (~8 kV/cm) across suspended cells in an electroporation cuvette.[2] Afterwards, the cells have to be handled carefully until they have had a chance to divide, producing new cells that contain reproduced plasmids. This process is approximately ten times more effective than chemical transformation.[4]
Electroporation is also highly efficient for the introduction of foreign genes into tissue culture cells, especially mammalian cells. For example, it is used in the process of producing knockout mice, as well as in tumor treatment, gene therapy, and cell-based therapy. The process of introducing foreign DNA into eukaryotic cells is known as transfection. Electroporation is highly effective for transfecting cells in suspension using electroporation cuvettes. Electroporation has proven efficient for use on tissues in vivo, for in utero applications as well as in ovo transfection. Adherent cells can also be transfected using electroporation, providing researchers with an alternative to trypsinizing their cells prior to transfection. One downside to electroporation, however, is that after the process the gene expression of over 7,000 genes can be affected.[5] This can cause problems in studies where gene expression has to be controlled to ensure accurate and precise results.
Although bulk electroporation has many benefits over physical delivery methods such as microinjections and gene guns, it still has limitations including low cell viability. Miniaturization of electroporation has been studied leading to microelectroporation and nanotransfection of tissue utilizing electroporation based techniques via nanochannels to minimally invasively deliver cargo to the cells.[6]
Electroporation has also been used as a mechanism to trigger cell fusion. Artificially induced cell fusion can be used to investigate and treat different diseases, like diabetes,[7][8][9] regenerate axons of the central nerve system,[10] and produce cells with desired properties, such as in cell vaccines for cancer immunotherapy.[11] However, the first and most known application of cell fusion is production of monoclonal antibodies in hybridoma technology, where hybrid cell lines (hybridomas) are formed by fusing specific antibody-producing B lymphocytes with a myeloma (B lymphocyte cancer) cell line.[12]
Gaurav Byagathvalli,1 Soham Sinha,2 Yan Zhang,2 Mark P. Styczynski,2 Janet Standeven,1 and M. Saad Bhamla2, ∗
1Lambert High School, 805 Nichols Rd, Suwanee, GA, 30024, USA2School of Chemical & Biomolecular Engineering,
Georgia Institute of Technology, 311 Ferst Drive NW, Altanta, GA 30332, USA
(Dated: December 21, 2018)
- N-Acetylaspartylglutamic acid, a neurotransmitter
Monty Python's Flying Circus
Electrophoresis
Electrophoresis is a laboratory technique used to separate DNA, RNA, or
protein molecules based on their size and electrical charge. An electric
current is used to move molecules to be separated through a gel. Pores
in the gel work like a sieve, allowing smaller molecules to move faster
than larger molecules. The conditions used during electrophoresis can be
adjusted to separate molecules in a desired size range.
Synchronous Serial Interface (SSI) Asynchronous Communication Is The Future Of Work
Electroporation of the skin to deliver antigen by using a piezo ceramic gas igniter
Chemical shift tensors: Theory and application to molecular structural problems
Plant PIEZO homologs modulate vacuole morphology during tip growth
Genome editing meets marsupials
Researchers at the RIKEN Center for Biosystems Dynamics Research (BDR) have succeeded in creating the first genetically engineered marsupial. This study, published in the scientific journal Current Biology, will contribute to deciphering the genetic background of unique characteristics observed only in marsupials.Time crystal
quantum computing
Eternal Change for No Energy: A Time Crystal Finally Made Real
Tribology
Tribotronics is an area of research that combines machine elements and electronic components to create active tribological systemsGoldberg polyhedron
See also
- Capsid
- Geodesic sphere
- Fullerene#Other buckyballs
- Conway polyhedron notation
- Goldberg–Coxeter construction
Transition state theory
Enzymatic reactions
The esteemed psychologist William James says, “If there are supernormal powers, it is through the cracked and fragmented self that they enter."
Cortex-M4
The Arm Cortex-M4 processor is Arm’s high performance embedded processor.
Tribology
Tribotronics is an area of research that combines machine elements and electronic components to create active tribological systemsA trion is a localized excitation which consists of three charged quasiparticles. A negative trion consists of two electrons and one hole and a positive trion consists of two holes and one electron. The trion itself is a quasiparticle and is somewhat similar to an exciton, which is a complex of one electron and one hole. The trion has a ground singlet state (spin s = 1/2) and an excited triplet state (s = 3/2). Here singlet and triplet degeneracies originate not from the whole system but from the two identical particles in it. The half-integer spin value distinguishes trions from excitons in many phenomena; for example, energy states of trions, but not excitons, are split in an applied magnetic field. Trion states were predicted theoretically and then observed experimentally in various optically excited semiconductors, especially in quantum dots and quantum well structures. There are experimental proofs of their existence in nanotubes supported by theoretical studies. Despite numerous reports of experimental trion observations in different semiconductor heterostructures, there are serious concerns on the exact physical nature of the detected complexes. The originally foreseen 'true' trion particle has a delocalized wavefunction (at least at the scales of several Bohr radii) while recent studies reveal significant binding from charged impurities in real semiconductor quantum wells.
Trions have been observed in atomically thin two-dimensional (2D) transition-metal dichalcogenide semiconductors. In 2D materials the form of the interaction between charge carriers is modified by the nonlocal screening provided by the atoms in the layer. The interaction is approximately logarithmic at short range and of Coulomb 1/r form at long range. The diffusion Monte Carlo method has been used to obtain numerically exact results for the binding energies of trions in 2D semiconductors within the effective mass approximation.
Wisdom of Solomon Chapter 13 Playing with Pyroelectricity Fermi Surface lattice dynamics doping nanopore semiconductors
By David Vincent Bell Hirsch
Nanopore
Max-flow min-cut theorem
Magnetic space group
Magnetic groups and time reversal
In addition to crystallographic space groups there are also magnetic space groups (also called two-color (black and white) crystallographic groups or Shubnikov groups). These symmetries contain an element known as time reversal. They treat time as an additional dimension, and the group elements can include time reversal as reflection in it. They are of importance in magnetic structures that contain ordered unpaired spins, i.e. ferro-, ferri- or antiferromagnetic structures as studied by neutron diffraction. The time reversal element flips a magnetic spin while leaving all other structure the same and it can be combined with a number of other symmetry elements. Including time reversal there are 1651 magnetic space groups in 3D (Kim 1999, p.428). It has also been possible to construct magnetic versions for other overall and lattice dimensions (Daniel Litvin's papers, (Litvin 2008), (Litvin 2005)).toward a psychology for the 21 st century I Edward F. Kelly
The Esalen Institute, commonly called Esalen, is a non-profit American retreat center and intentional community in Big Sur, California, which focuses on humanistic alternative education. The Institute played a key role in the Human Potential Movement beginning in the 1960s. Its innovative use of encounter groups, a focus on the mind-body connection, and their ongoing experimentation in personal awareness introduced many ideas that later became mainstream.
Parallel Circuits
A multiferroic molecular magnetic qubit
Charles Proteus Steinmetz
(April 9, 1865, - October 26, 1923)
AC hysteresis theory
In mathematics, a Casimir element (also known as a Casimir invariant or Casimir operator) is a distinguished element of the center of the universal enveloping algebra of a Lie algebra. A prototypical example is the squared angular momentum operator, which is a Casimir element of the three-dimensional rotation group.
Department of Physics | The University of Texas at Austin
Magnetic space group, Graphene reinforced CSA Cement, minimum-cost flow problem (MCFP)
By David Vincent Bell HirschThe University of Texas: Department of Computer
Machine Learning & Artificial Intelligence
Peak shift principle
This psychological phenomenon is typically known for its application in animal discrimination learning. In the peak shift effect, animals sometimes respond more strongly to exaggerated versions of the training stimuli. For instance, a rat is trained to discriminate a square from a rectangle by being rewarded for recognizing the rectangle. The rat will respond more frequently to the object for which it is being rewarded to the point that a rat will respond to a rectangle that is longer and more narrow with a higher frequency than the original with which it was trained. This is called a supernormal stimulus. The fact that the rat is responding more to a 'super' rectangle implies that it is learning a rule.This effect can be applied to human pattern recognition and aesthetic preference. Some artists attempt to capture the very essence of something in order to evoke a direct emotional response. In other words, they try to make a 'super' rectangle to get the viewer to have an enhanced response. To capture the essence of something, an artist amplifies the differences of that object, or what makes it unique, to highlight the essential features and reduce redundant information. This process mimics what the visual areas of the brain have evolved to do and more powerfully activates the same neural mechanisms that were originally activated by the original object.
Communication protocol
Kermit (protocol)
Kermit hops to cure Muscular Dystrophy
Step-by-step guide to making your first request to the new Twitter API v2
You Can Now Genetically Engineer Your Own Mutant Frogs For $499
A well-known biohacker wants to help you channel your inner geneticist.
KERMIT? IS THAT YOU?
New gene-editing kit puts the power of frog growth into citizen scientists' hands
by Helen Santoro
Josiah Zayner
A Biohacker Regrets Publicly Injecting Himself With CRISPR
“There’s no doubt in my mind that somebody is going to end up hurt eventually.”
Welcome to python-twitter’s documentation!
selenium-webdriver
Selenium is a browser automation library. Most often used for testing web-applications, Selenium may be used for any task that requires automating interaction with the browser.
You will need to download additional components to work with each of the major browsers. The drivers for Chrome, Firefox, and Microsoft's IE and Edge web browsers are all standalone executables that should be placed on your system PATH. Apple's safaridriver is shipped with Safari 10 for OS X El Capitan and macOS Sierra. You will need to enable Remote Automation in the Develop menu of Safari 10 before testing.
| Browser | Component |
|---|---|
| Chrome | chromedriver(.exe) |
| Internet Explorer | IEDriverServer.exe |
| Edge | MicrosoftWebDriver.msi |
| Firefox | geckodriver(.exe) |
| Safari | safaridriver |
TensorFlow makes it easy for beginners and experts to create machine learning models.
Quantum jump method
Psychophysics quantitatively investigates the relationship between physical stimuli and the sensations and perceptions they produce.Physicists' finding could revolutionize information transmission
Psychoneuroimmunology (PNI), also referred to as psychoendoneuroimmunology (PENI) or psychoneuroendocrinoimmunology (PNEI), is the study of the interaction between psychological processes and the nervous and immune systems of the human body.Cell force sensing using thin elastomer films
These hybrid schools of Psychophysics as well Psychoneuroimmunology have some considerations with Artificial Intelligent sensors for innovation applications.E-textiles
Python Programming, Myocyte modeling of COL6A1 2 3 muscle tissue engineering on CpG islands
Linking phenotypes to genotypes: A newly devised gene-editing strategy
Exponential (myofibrils) growth
In particle physics, a pion (or a pi meson, denoted with the Greek letter pi:
π
) is any of three subatomic particles:
π0,
π+, and
π−.
Skyrmions and Antiskyrmions in Quasi-Two-Dimensional Magnets
Each pion consists of a quark and an antiquark and is therefore a meson. Pions are the lightest mesons and, more generally, the lightest hadrons.Natural language processing
Magnetic materials/data storage
One particular form of skyrmions is magnetic skyrmions, found in magnetic materials that exhibit spiral magnetism due to the Dzyaloshinskii-Moriya interaction, double-exchange mechanism or competing Heisenberg exchange interactions.Interpretations of quantum mechanics
Photonic-crystal fiber (PCF) is a class of optical fiber based on the properties of photonic crystals. It was first explored in 1996 at University of Bath, UK.
Pluripotency
In cell biology, pluripotency (Lat. pluripotentia, "ability for many [things]") Induced pluripotent stem cells, commonly abbreviated as iPS cells or iPSCs, are a type of pluripotent stem cell artificially derived from a non-pluripotent cell, typically an adult somatic cell, by inducing a "forced" expression of certain genes and transcription factorsInduced pluripotent stem cell
Paramagnetic compounds (and atoms) are attracted to magnetic fields while diamagnetic compounds (and atoms) are repelled from magnetic fields.Non-homologous end joining (NHEJ) is a pathway that repairs double-strand breaks in DNA
The Lennard-Jones potential (also termed the L-J potential, 6-12 potential, or 12-6 potential) is a mathematically simple model that approximates the interaction between a pair of neutral atoms or molecules. A form of this interatomic potential was first proposed in 1924 by John Lennard-Jones.
Sodium bisulfate
Identification of DNA-Methylated CpG Islands Associated With Gene Silencing in the Adult Body Tissues of the Ogye Chicken Using RNA-Seq and Reduced Representation Bisulfite Sequencing
- 1Genome Editing Research Center, Korea Research Institute of Bioscience and Biotechnology, Daejeon, South Korea
- 2Department of Bioinformatics, KRIBB School of Bioscience, University of Science and Technology, Daejeon, South Korea
Gene silencing is the regulation of gene expression in a cell to prevent the expression of a certain gene. Gene silencing can occur during either transcription or translation and is often used in research.
CpG islands, Maui, Myocyte models
Learn more about CpG Island
CpG sites
Gene drive
Selfish genetic element
The Molecular Modeling Toolkit
The Molecular Modelling Toolkit (MMTK) is an Open Source program library for molecular simulation applications. In addition to providing ready-to-use implementations of standard algorithms, MMTK serves as a code basis that can be easily extended and modified to deal with standard and non-standard problems in molecular simulations.
The three most common usage patterns of MMTK are:
-
Writing Python scripts that make use of MMTK functions for standard simulation and modelling applications. This is similar to using other simulation packages with a scripting language (i.e. CHARMM or Gromos), but with the added advantage of having access to lots of useful Python modules from elsewhere.
-
Writing modules that interact closely with MMTK (and perhaps other packages) to solve problems for which no standard solution exists. For example, adding a particular force field term or a particular simulation or analysis algorithm. There is not much competition for MMTK in that domain.
-
Writing application programs in Python that use MMTK internally, for users that do not need to know anything about such internals. Those programs can provide easy-to-use graphical interfaces (see e.g. DomainFinder and nMOLDYN) or be integrated into a Web service (see e.g. WEBnm@).
Langevin equation
Solutions of the Kramers Equation
Kramers Equation
Kramers' law
Kramers theorem
Grote–Hynes theory
Groot (Marvel Cinematic Universe)
Laplace transform
Protein dynamics, thermal stability, and free-energy landscapes: a molecular dynamics investigation
Outer sphere electron transfer
Genus (mathematics)
Non-orientable surfaces
Graph Hole
Einstein relation (kinetic theory)
Solvent model
Applications to QSAR and QSPR
The Born-Oppenheimer Approximation Simplifies the Schrödinger Equation for Molecules
The Self-Consistent Field and the Hartree-Fock Limit
Forming limit prediction using a self-consistent crystal plasticity framework: a case study for body-centered cubic materials
Anisotropy
Multi-configurational self-consistent field
List of quantum chemistry and solid-state physics software
List of software for nanostructures modeling
Diabatic
SCRF
Kirkwood-Onsager Model
Linear isotropic dielectrics
Self-Consistent Reaction Field
Electric displacement field
Isotropic Medium
Apparent surface charge models
Boundary element method
Tessellation
Two-dimensional tessellation by molecular tiles constructed from halogen–halogen and halogen–metal networks
Molecular Hamiltonian
Clamped nucleus Hamiltonian
The Born-Oppenheimer approximation
GEPOL: An improved description of molecular surfaces. I. Building the spherical surface set
Advanced and retarded Green's functions
The surface command creates and displaysmolecular surfaces, either atomically detailed solvent-excluded surfaces (default) or lower-resolution Gaussian surfaces.
MDAnalysis
A Python package for the handling and analysis of molecular simulations data.
Reaction Mechanism Generator
Curry–Howard correspondence
Hilbert-style deduction systems and combinatory logic
Peirce's law
Pierce oscillator
Random forest
Random forests or random decision forestsPreliminaries: decision tree learning
Logical intuition
Logical Intuition, or mathematical intuition or rational intuition, is a series of instinctive foresight, know-how and savviness often associated with the ability to perceive logical or mathematical truth—and the ability to solve mathematical challenges efficiently.[1][2] Humans apply logical intuition in proving mathematical theorems,[3] validating logical arguments,[4] developing algorithms and heuristics,[5] and in related contexts where mathematical challenges are involved.[6] The ability to recognize logical or mathematical truth and identify viable methods may vary from person to person, and may even be a result of knowledge and experience, which are subject to cultivation.[7] The ability may not be realizable in a computer program by means other than genetic programming or evolutionary programming.[8]
Monkey King Festival
The Monkey King Festival (Chinese: 齊天大聖千秋) is celebrated in Hong Kong on the 16th day of the eighth Lunar month of the Chinese calendar, corresponding to September according to the Common era calendar, a day after the Mid Autumn Festival. The origin of the festival is traced to the epic 16th century novel Journey to the West (Xiyou Ji, 西遊記) written by the Chinese novelist Wu Cheng'en (1500–1582) during the Ming Dynasty (1368–1644).[1][2] The novel brings out the concept of immortality from Taoism and rebirth from Buddhism.[3] The monkey Sun Wukong, a character in the novel, is the featured figure of the festival.[1]Jayanti (Hinduism)
Just hang in there and let go
Amoghasiddhi
Bagalamukhi
Creation of the first human–monkey chimera
Wildlife Tonight
Kruskal–Wallis one-way analysis of variance
Method
Jonckheere's trend test
Chocolatey
Ātman (Hinduism)
Ātman (/ˈɑːtmən/; Sanskrit: आत्मन्) is a Sanskrit word that means inner self, spirit, or soul.[1][2] In Hindu philosophy, especially in the Vedanta school of Hinduism, Ātman is the first principle:[3] the true self of an individual beyond identification with phenomena, the essence of an individual. In order to attain Moksha (liberation), a human being must acquire self-knowledge (atma Gyan). For the different schools of thought, self-realization is that one's true self (Jīvātman) and the ultimate reality (Brahman) are: completely identical (Advaita, Non-Dualist),[2][4] completely different (Dvaita, Dualist), or simultaneously non-different and different (Bhedabheda, Non-Dualist + Dualist).[5]
The six orthodox schools of Hinduism believe that there is Ātman in every living being (jiva). This is a major point of difference with the Buddhist doctrine of Anatta, which holds that there is no soul or self.[6][7][8]
First human-monkey chimera raises concern among scientists
Bhringi
Skull and Bones
Rag-and-bone man
Ex-solicitor general says Trump 'talking like a mafia boss, and not a particularly smart mafia boss'
The 13 most powerful members of 'Skull and Bones'
Mar 19, 2017Saturn at opposition August 1-2, near Jupiter
Opposition (astronomy)
Ripples in Saturn’s Rings Reveal Planet’s Core Is Big and Jiggly
Saturn may have a "fuzzy" core, according to new research.
Paksha
Apparent retrograde motion
Green's function (many-body theory)
The signs of the Green functions have been chosen so that Fourier transform of the two-point () thermal Green function for a free particle is
and the retarded Green function is
where
![\omega_n = {[2n+\theta(-\zeta)]\pi}/{\beta}](https://wikimedia.org/api/rest_v1/media/math/render/svg/44cd3a86b0094b73ae59d44030fa4f393eb832e4)
is the Matsubara frequency.
Monkey mind
Happy birthday to you, happy birthday to you Monkey God, you smell like a divine Monkey God, and act like one too!Nine Emperor Gods Festival
The Nine Emperor Gods Festival (Malay: Perayaan Dewa Sembilan Maharaja, Thai: เทศกาลกินเจ) is a nine-day Taoist celebration beginning on the eve of the ninth lunar month of the Chinese calendar, nine-emperor-gods-festival-Navaratri
A recurrent COL6A1 pseudoexon insertion causes muscular dystrophy and is effectively targeted by splice-correction therapies
1Pauli matrices
Gutzwiller wave function
Louis de Broglie
Matter and wave–particle duality
Matter wave
De Broglie hypothesis
Hydrophile
Molecular Geometry
VSEPR
Surface tension
wave
Antimatter
wave...
Hydrodynamic quantum analogs
John W M Bush3,1
Hydrophobe
Extracellular Collagen VI Has Prosurvival and Autophagy Instructive Properties in Mouse Fibroblasts
Molecular tweezers Electron donor Lone pair Angle changes of some Hairy ball theorem
Mesenchymal stem cell
Fibroblast
Von Neumann universal constructor
Inventing Game of Life (John Conway) - Numberphile
Duchenne Muscular Dystrophy Mice and Men
NCI PhaseIIB Bridge Award
Closing in on a cure for Duchenne muscular dystrophy
Minority Business Development Agency
with work of
Eric Olson, Ph.D.
Annie and Willie Nelson Professorship in Stem Cell Research; Pogue Distinguished Chair in Research on Cardiac Birth Defects; The Robert A. Welch Distinguished Chair in ScienceDavid J. Hardy
Contact Information
Girls rarely develop DMD because they have two dystrophin genes, whereas boys have just one. A girl's healthy gene tends to override her mutated one, causing mild if any symptoms.
Causes/Inheritance
Partitioning Around Medoids (PAM)
PAM Partitioning Around Medoids and PAM Protospacer Adjacent Motif with Pax Genes:Pax genes
I Ching & Insights into
Tao of Chaos: Merging East and West
Muscular Dystrophy Information Page
CRISPR/Cpf1
Pax3/Pax7 mark a novel population of primitive myogenic cells during development
Human skeletal muscle organoids model fetal myogenesis and sustain uncommitted PAX7 myogenic progenitors
| ||||
- Parent SBIR PA (Clinical Trial Not Allowed) PA-21-259: PHS 2021-2 Omnibus Solicitation of the NIH, CDC and FDA for Small Business Innovation Research Grant Applications (Parent SBIR [R43/R44] Clinical Trial Not Allowed)
- Parent STTR PA (Clinical Trial Not Allowed) PA-21-262: PHS 2021-2 Omnibus Solicitation of the NIH for Small Business Technology Transfer Grant Applications (Parent STTR [R41/R42] Clinical Trial Not Allowed)
The next deadline is Sept. 5th, 2021.
Deep Reinforcement Learning
Dexamethasone accelerates muscle regeneration by modulating kinesin-1-mediated focal adhesion signals
- Jong-Wei Lin,
- Yi-Man Huang,
- Yin-Quan Chen,
- Ting-Yun Chuang,
- Tien-Yun Lan,
- Yen-Wenn Liu,
- Hung-Wei Pan,
- Li-Ru You,
- Yang-Kao Wang,
- Keng-hui Lin,
- Arthur Chiou &
- Jean-Cheng Kuo
Dystrophin Dp71 and the Neuropathophysiology of Duchenne Muscular Dystrophy
Dystrophin
Absence of Dystrophin Disrupts Skeletal Muscle Signaling: Roles of Ca2+, Reactive Oxygen Species, and Nitric Oxide in the Development of Muscular Dystrophy
The Dystrophin Glycoprotein Complex
Kinesin, an example of a molecular motor that uses ATP to "walk" along nanotubules, is now thought to be an example of a Brownian motor.
Dreidel driven scientific research!
Brownian motor
In more recent times, humans have attempted to apply this knowledge of natural Brownian motors to solve human problems. The applications of Brownian motors are most obvious in nanorobotics due to its inherent reliance on directed motion.
Muller's ratchet
Genetic hitchhiking
Experimental realization of Feynman's ratchet
Jaehoon Bang8,1, Rui Pan8,2
, Thai M Hoang9,3, Jonghoon Ahn1, Christopher Jarzynski4Ratchet and pawl
Bohm diffusion
The diffusion of plasma across a magnetic field was conjectured to follow the Bohm diffusion scaling as indicated from the early plasma experiments of very lossy machines. This predicted that the rate of diffusion was linear with temperature and inversely linear with the strength of the confining magnetic field. (see CodingtheMatrix Lossy compression notes, much further in this research article)
Collective identity Fusion in The difficult art of giving space(time) when you love someone (with a drude particle on their shoulder)
A hot-cold empathy gap is a cognitive bias in which people underestimate the influences of visceral drives on their own attitudes, preferences, and behaviors.[1]
The most important aspect of this idea is that human understanding is "state-dependent". For example, when one is angry, it is difficult to understand what it is like for one to be calm, and vice versa; when one is blindly in love with someone, it is difficult to understand what it is like for one not to be, (or to imagine the possibility of not being blindly in love in the future). Importantly, an inability to minimize one's gap in empathy can lead to negative outcomes in medical settings (e.g., when a doctor needs to accurately diagnose the physical pain of a patient),[2] and in workplace settings (e.g., when an employer needs to assess the need for an employee's bereavement leave).[3]
Hot-cold empathy gaps can be analyzed according to their direction:[2]
- Hot-to-cold: People under the influence of visceral factors (hot state) don't fully grasp how much their behavior and preferences are being driven by their current state; they think instead that these short-term goals reflect their general and long-term preferences.
- Cold-to-hot: People in a cold state have difficulty picturing themselves in hot states, minimizing the motivational strength of visceral impulses. This leads to unpreparedness when visceral forces inevitably arise.
They can also be classified in regards to their relation with time (past or future) and whether they occur intra- or inter-personally:[2]
- intrapersonal prospective: the inability to effectively predict their own future behavior when in a different state. See also projection bias.[4]
- intrapersonal retrospective: when people recall or try to understand behaviors that happened in a different state. See retrospective hot-cold empathy gaps.
- interpersonal: the attempt to evaluate behaviors or preferences of another person who is in a state different from one's own.
The term hot-cold empathy gap was coined by Carnegie Mellon University psychologist, George Loewenstein. Hot-cold empathy gaps are one of Loewenstein's major contributions to behavioral economics.
The Fisher–Yates shuffle is an algorithm for generating a random permutation of a finite sequence—in plain terms, the algorithm shuffles the sequence. The algorithm effectively puts all the elements into a hat; it continually determines the next element by randomly drawing an element from the hat until no elements remain. The algorithm produces an unbiased permutation: every permutation is equally likely. The modern version of the algorithm is efficient: it takes time proportional to the number of items being shuffled and shuffles them in place.
The Fisher–Yates shuffle is named after Ronald Fisher and Frank Yates, who first described it, and is also known as the Knuth shuffle after Donald Knuth. A variant of the Fisher–Yates shuffle, known as Sattolo's algorithm, may be used to generate random cyclic permutations of length n instead of random permutations
In mathematics, particularly in matrix theory, a permutation matrix is a square binary matrix that has exactly one entry of 1 in each row and each column and 0s elsewhere. Each such matrix, say P, represents a permutation of m elements and, when used to multiply another matrix, say A, results in permuting the rows (when pre-multiplying, to form PA) or columns (when post-multiplying, to form AP) of the matrix A.
Composition of permutations
Octet rule
Topological quantum computer
A topological quantum computer is a theoretical quantum computer that employs two-dimensional quasiparticles called anyons, whose world lines pass around one another to form braids in a three-dimensional spacetime (i.e., one temporal plus two spatial dimensions). These braids form the logic gates that make up the computer. The advantage of a quantum computer based on quantum braids over using trapped quantum particles is that the former is much more stable. Small, cumulative perturbations can cause quantum states to decohere and introduce errors in the computation, but such small perturbations do not change the braids' topological properties. This is like the effort required to cut a string and reattach the ends to form a different braid, as opposed to a ball (representing an ordinary quantum particle in four-dimensional spacetime) bumping into a wall. Alexei Kitaev proposed topological quantum computation in 1997. While the elements of a topological quantum computer originate in a purely mathematical realm, experiments in fractional quantum Hall systems indicate these elements may be created in the real world using semiconductors made of gallium arsenide at a temperature of near absolute zero and subjected to strong magnetic fields.Moneta
Achaemenid coinage
Mnemosyne
Temple of Juno Moneta
Mexican silver coins in silky minority business history
Afonso de Albuquerque
The Doge Enrico Dandolo and the conquest of Constantinople
Doge Coin, Oh Really Enrico Dandolo?You Goa Fonzi de Albuquerque, buy that news and sell that rumor...
Cryptocurrency and crime
The criminal practice of money laundering carried out in cyberspace through online transactions has been termed as cyber-laundering. Money launderers are constantly looking for new ways to avoid detection from law enforcement, and the Internet has opened a large window of opportunities for them.There’s a new way to break quantum cryptography
Can Blockchains Survive the Quantum Computer?
Money is Memory
Cleansing of the Temple
Implementing the Drude Polarizable Force Field in NAMD
Theoretical and Computational Biophysics Group
Which version of NAMD should I download?
NAMD for NMDA
N-Methyl-D-aspartic acid or N-Methyl-D-aspartate (NMDA)
NMDA receptor function, memory, and brain aging
Two-dimensional materials
Surjective function
Injective function
Myosin V regulates synaptopodin clustering and localization in the dendrites of hippocampal neurons
Marina MikhaylovaThe actin-modulating protein synaptopodin mediates long-term survival of dendritic spines
Synaptic clustering within dendrites: An emerging theory of memory formation
Author links open overlay panelGeorgeKastellakisDenise J.CaiSara C.MednickAlcino J.SilvaPanayiotaPoiraziSynaptic Clustering and Memory Formation
Myosin: The Actin Motor Protein
Nano--Robotics
in Medical Applications: Robotics in Medical Applications: From Science
Fiction to Reality
Constantinos Mavroidis, Ph.D., Professor
Bio Nanorobotics Laboratory
Department of Mechanical and Industrial Engineering
Northeastern University, Boston, Massachusetts
Transportin 3 gene bubble babies Wu Long Jiao Zhu Writhe Applications in DNA topology, Micro-Managing Myocyte Mitosis, CpG islands and python programing mathematical Myocyte models
The mutation of Transportin 3 gene that causes limb girdle muscular dystrophy 1F induces protection against HIV-1 infection
Novel mutation in TNPO3 causes congenital limb-girdle myopathy with slow progression
Black Box Accounting
Transportin-3
Spanish scientists make breakthrough identifying HIV resistance gene
TNPO3 Gene
David Vetter
CCR5
CCR5: From Natural Resistance to a New Anti-HIV Strategy
CCR5 C-C motif chemokine receptor 5 [ Homo sapiens (human) ]
American scientist played more active role in ‘CRISPR babies’ project than previously known
Linkage disequilibrium
Specificity in Biological Interactions: Proceedings of a Working Group
surface constrained soft sphere dipolesWrinkling crystallography on spherical surfaces
Computer Simulation of Biomolecular Systems: Theoretical and Experimental
surface constrained soft sphere dipolesHaplotype
A haplotype (haploid genotype) is a group of alleles in an organism that are inherited together from a single parent.[1][2]See also
- Haplotype estimation
- International HapMap Project
- Genealogical DNA test
- Haplogroup
- Y-STR
- PLINK (genetic tool-set)
- Haplogroup E-M215 (Y-DNA)
Quantum Clustering Algorithms
Hamiltonian (quantum mechanics)
Molecular Hamiltonian
Determining the Therapeutic Window: Central Nervous System Administration for Vector Mediated Gene Replacement in a Severe Model of Spinal Muscular Atrophy
Nonequilibrium Dissipation-free Transport in F1-ATPase and the Thermodynamic Role of Asymmetric Allosterism
Abstract
F1-ATPase (or F1), the highly efficient and reversible biochemical engine, has motivated physicists as well as biologists to imagine the design principles governing machines in the fluctuating world. Recent experiments have clarified yet another interesting property of F1; the dissipative heat inside the motor is very small, irrespective of the velocity of rotation and energy transport. Conceptual interest is devoted to the fact that the amount of internal dissipation is not simply determined by the sequence of equilibrium pictures, but also relies on the rotational-angular dependence of nucleotide affinity, which is a truly nonequilibrium aspect. We propose that the totally asymmetric allosteric model (TASAM), where adenosine triphosphate (ATP) binding to F1 is assumed to have low dependence on the angle of the rotating shaft, produces results that are most consistent with the experiments. Theoretical analysis proves the crucial role of two time scales in the model, which explains the universal mechanism to produce the internal dissipation-free feature. The model reproduces the characteristic torque dependence of the rotational velocity of F1 and predicts that the internal dissipation upon the ATP synthesis direction rotation becomes large at the low nucleotide condition.
System administrator
phreak
by
Eric Arnold Anderson
Doctor of Philosophy in Computer Science
University of California at Berkeley
Matthew L. Massie a,1, Brent N. Chun b
Floquet theory
Cat state
Time crystal
Broken symmetry in discrete time crystals
Higher-order and fractional discrete time crystals in clean long-range interacting systems
Fractal Nanotechnology
1Intron
Iteration
Structural biology
Protein topology
Self‑splicing by group I introns (pre‑rRNA of Tetrahymena)
Group I and group II introns
Protein structure prediction
Fractal Landscapes and Molecular Evolution: Modeling the Myosin HeavyChain Gene Family
S. V. Buldyrev,* A. L. Goldberger,* S. HavIin,* C-K. Peng,* H. E. Stanley,* M. H. R. Stanley,* and M. Simons*§
Preon
Exciton
Point group
Crystallography
X-ray crystallography (XRC)
Biological macromolecular crystallography
Cryo bio-crystallography
Exitron
Exon shuffling
Exon skipping
| drug | exon | company | UD FDA approval |
|---|---|---|---|
| eteplirsen | 51 | Sarepta | September 2016 |
| golodirsen | 53 | Sarepta | December 2019 |
| viltolarsen | 53 | NS Pharma | August 2020 |
| casimerson | 45 | Sarepta | March 2021 |
Dicer
Gene silencing
A common COL6A1 deep-intronic pseudo-exon inserting mutation causes a distinct phenotype of Ullrich congenital muscular dystrophy
Exon-Skipping Oligonucleotides Restore Functional Collagen VI by Correcting a Common COL6A1 Mutation in Ullrich CMD
A recurrent COL6A1 pseudoexon insertion causes muscular dystrophy and is effectively targeted by splice-correction therapies
RNA polymerase
DNA shuffling
RNA interference
RNA splicing
RNA editing
Trans-activating crRNA (tracrRNA)
DNA sequencing
Exon-intron database
DNA Walking and Rolling Nanomachine for Electrochemical Detection of miRNA
Peng Miao, Yuguo TangSequence based prediction of enhancer regions from DNA random walk
Nanomedicine
Nanozymes
CasX enzymes comprise a distinct family of RNA-guided genome editors
Cas1
Cas2
Cas3
Cas4
Cas9
CRISPR gene editing
RNA polymerase
Zinc finger nuclease
Beta-secretase 1
Homing endonuclease
Guide RNA
Small interfering RNA (siRNA)
Penrose tiling and Senator Penrose on the road with Truman and Eisenhower
By David Vincent Bell Hirsch
Fractals in the Body
Not only are fractals in the world all around us - they are even INSIDE us! In fact, many of our internal organs and structures display fractal properties.
Molecular tweezers Electron donor Lone pair Angle changes of some Hairy ball theorem
By David Vincent Bell Hirsch
Alpha helix
Breakthrough in materials discovery enables 'twistronics' for bulk systems
Van der Waals surface
Continuum mechanics
The Continuing Story Of Bungalow Bill (Remastered 2009)
Molecular entity
Biomolecular engineering
Cartesian coordinate system
DNA-binding protein
Accessible surface area
Vertical-cavity surface-emitting laser
(see it in a laser light show all cyro x ray crystallography)Relation to solvent-excluded surface
van der Waals Equation of State
Molecular surface may refer to one of the following.
- the van der Waals surface
- Accessible surface area or Connolly surface
- any of isosurfaces for a molecule
Manjeera Mantina, Adam C. Chamberlin, Rosendo Valero, Christopher J. Cramer, and
Donald G. Truhlar
If no other force is present, the distance between atoms at which the force becomes repulsive rather than attractive as the atoms approach one another is called the Van der Waals contact distance; this phenomenon results from the mutual repulsion between the atoms' electron clouds.[1] The Van der Waals force has the same origin as the Casimir effect, which arises from quantum interactions with the zero-point field.[2]
The Van der Waals forces [3] are usually described as a combination of the London dispersion forces between "instantaneously induced dipoles",[4] Debye forces between permanent dipoles and induced dipoles, and the Keesom force between permanent molecular dipoles whose rotational orientations are dynamically averaged over time.
If no other forces are present, the point at which the force
becomes repulsive rather than attractive as two atoms near one another
is called the van der Waals contact distance.
This results from the electron clouds of two atoms unfavorably coming
into contact. It can be shown that van der Waals forces are of the same
origin as that of the Casimir effect, arising from quantum interactions
with the zero-point field.
Magnetic 2D materials
Two-dimensional semiconductor
2021 quantum materials roadmap
van der Waals metamaterials
William Dorrell, Harris Pirie, S. Minhal Gardezi, Nathan C. Drucker, and Jennifer E. Hoffman
Phys. Rev. B 101, 121103(R) – Published 5 March 2020
Van der Waals constants (data page)
Van der Waerden test of maximum clique problem with Waring's conjecture upon Van der Waals force
By David Vincent Bell Hirsch
Opto-spintronics
Spectroscopy of dimers, trimers and larger clusters of linear molecules
Motivation and the Hartree Product
Hartree equation
Hard spheres
Sphere
Applications of quantum mechanics
Magnetic resonance (quantum mechanics)
Molecular orbital
Hybrid functional
Antibonding Orbital Definition
Roothaan equations
List of quantum chemistry and solid state physics software
Structural Biochemistry/Chemical Bonding/Van der Waals interaction
Operator (mathematics)
Laplace operator
Linear combination of atomic orbitals
Semi-empirical quantum chemistry method
Comparing Lattice Energy for Ionic Compounds Using Coulomb's Law
Parametrization (geometry)
Parametric equation
Bispinor
Microcanonical ensemble
Molecular physics
Ergodic hypothesis
Ergodicity
Step-by-step guide to making your first request to the new Twitter API v2
Welcome to python-twitter’s documentation!
Slutsky Equation, Roy�s Identity and Shephard's Lemma
Logic of relatives
Identity (mathematics)
Arity
Arity (/ˈærɪti/ (
What Does Tilde (~) Mean?
The tilde (~) is a character in the standard ASCII character set that is provided on a conventional computer keyboard and is used in both writing and computer programming. It corresponds to ASCII code 126.The tilde is also sometimes known as the twiddle.
Positron
Onium
Onium ion
ONIOM
The ONIOM (short for 'Our own n-layered Integrated molecular Orbital and Molecular mechanics') method is a computational approach developed by Morokuma and co-workers. ONIOM is a hybrid method that enables different ab initio or semi-empirical methods to be applied to different parts of a molecule/system in combination to produce reliable geometry and energy at reduced computational cost.[1][2][3]
The ONIOM computational approach has been found to be particularly useful for modeling biomolecular systems[4] as well as for transition metal complexes and catalysts.[5]
Comparison of software for molecular mechanics modeling
QM/MM
Calculating the energy of the combined system
Many body localization
Hamiltonian (quantum mechanics)
Dirac formalism
Heisenberg-Langevin formalism for
Muscle loss can cause a range of health problems as we age – but it can be prevented
Sarcopenia With Aging
Preserve your muscle mass
Declining muscle mass is part of aging, but that does not mean you are helpless to stop it.
How a tiny, wobbling particle could unlock mysteries of the universe
The results of a new muon experiment are stirring up particle physics.
Oxyanion
Nuclear geometry and rapid mitosis ensure asymmetric episome segregation in yeast
math-as-code (Python version)
No matter how much you push the nuclear envelope, it'll still be stationery mail with your nuclear family. Nuclear localization sequence Database of protein domains, families and functional sites
Nuclear envelope
The nuclear envelope, also known as the nuclear membrane,[1][a] is made up of two lipid bilayer membranes that in eukaryotic cells surrounds the nucleus, which encases the genetic material.
The nuclear envelope consists of two lipid bilayer membranes: an inner nuclear membrane and an outer nuclear membrane.[4] The space between the membranes is called the perinuclear space. It is usually about 20–40 nm wide.[5][6] The outer nuclear membrane is continuous with the endoplasmic reticulum membrane.[4] The nuclear envelope has many nuclear pores that allow materials to move between the cytosol and the nucleus.[4] Intermediate filament proteins called lamins form a structure called the nuclear lamina on the inner aspect of the inner nuclear membrane and give structural support to the nucleus.[4]
Hell
Eukaryote
Nucleic acids
Finding nuclear localization signals
Expression (computer science)
Anti-CRISPR
Genetic programming
The kill-switch for CRISPR that could make gene-editing safer
By Katie Palmer
ADNP Genetics
This condition is caused by mutations in the ADNP gene. This gene is located on the long arm of chromosome 20 (20q13.13).
ADNP has been associated with abnormalities in the autophagy pathway in schizophrenia.[2]
Server-side I/O Performance: Node vs. PHP vs. Java vs. Go
Sex-Dependent Effects of Cannabis and Cannabinoids: A Translational Perspective
Gandaberunda
Bhang
Mahakala
Bhairava
Akash Bhairav
The Catholic Bishops’ Brawl Over Denying Joe Biden Communion
Sex-abuse victims of former priest John Geoghan charge that Cardinal Bernard Law was told of Geoghan’s criminal activity as early as 1984 but did nothing to stop it.
CCHR Warns: Psychiatric Sexual Assault of Patients is all too Common Occurrence
Sexual crimes committed by psychiatrists are estimated at 37 times greater than rapes occurring in the general community
Speak Out About Psychiatrist/Psychologist Sexual Abuse
Billy Crystal got super stoned inside an MRI machine after eating too many weed gummies, then asked his doctor for Taco Bell
SOAP (TV Show 1977) Herbie Goes On - Season 1 Episode 6
Disinhibition
Benson (TV series)
Matthew 5:44 New King James Version (NKJV)
44 But I say to you, love your enemies, bless those who curse you, do good to those who hate you, and pray for those who spitefully use you and persecute you,
take (something) on faith
To accept something without further verifying or investigating, based on trust.
SOAP vs. REST: A Look at Two Different API Styles
Bad faith is double mindedness or double heartedness in duplicity,
fraud, or deception. It may involve intentional deceit of others, or
self-deception.
The expression "bad faith" is associated with "double heartedness",
which is also translated as "double mindedness".
The Hungarian-American psychiatrist and writer Thomas Szasz,
who has died aged 92, was regarded by many as the leading 20th- and
21st-century moral philosopher of psychiatry and psychotherapy
The Myth of Mental Illness: Foundations of a Theory of Personal Conduct is a 1961 book by the psychiatrist Thomas Szasz, in which the author criticizes psychiatry and argues against the concept of mental illness.
Sexual Abuse of Minors by Catholic Clergy
Dr. Richard Fitzgibbons, M.D. and Dale O'Leary, Mrs.Vagus Nerve as Modulator of the Brain–Gut Axis in Psychiatric and Inflammatory Disorders
Single Page CRUD Application (SPA) using ASP.NET Web API, MVC and Angular.js
Creating a Single Page Application (SPA) with React and Bootstrap
App Engine
Promises
Angular promises vs observables
Dielectric
Debye relaxation
Debye toroidal moment of surface plasmons as SBIR ESCO model
Quantitative structure–activity relationship
(QSAR models)
Matched molecular pair analysis
Electromagnetism is a property of spacetime itself, study finds
Matched molecular pair analysis (MMPA)
Reaction path Hamiltonian for polyatomic molecules
Curry–Howard correspondence
Statistics (scipy.stats)¶
31 SWIG and Python
Patrick Smyth
Entry point
In computer programming, an entry point is a point in a program where the execution of a program begins, and where the program has access to command line arguments. [1]Peirce's law
Dancing Italian Frogs and Toadies, Stooges v. Prescription Thugs, Olympic Gold
By David Vincent Bell HirschCurrying
See also
Quantum entanglement
Hall word
Markov odometer
Dyck language
Currying
Curry
Biomarkers and Biosensors
Detection and Binding to Biosensor Surfaces and Biomarkers Applications
Book • 2014
Molecular methods in the laboratory diagnosis of sexually transmitted infections
A
nine-month investigation by the Guardian and Consumer Reports found
alarming levels of forever chemicals, arsenic and lead in samples taken
across the US
How to test your drinking water
Get in a Curry... spicy hot
A nine-month investigation by the Guardian and Consumer Reports found alarming levels of forever chemicals, arsenic and lead in samples taken across the US
How to test your drinking water
Get in a Curry... spicy hot
New Mexico faces extreme water scarcity on par with the United Arab Emirates. Experts warn more 'day zeros' are looming.
Aug 7, 2019Bicyclic semigroup
In mathematics, the bicyclic semigroup is an algebraic object important for the structure theory of semigroups. Although it is in fact a monoid, it is usually referred to as simply a semigroup. It is perhaps most easily understood as the syntactic monoid describing the Dyck language of balanced pairs of parentheses. Thus, it finds common applications in combinatorics, such as describing binary trees and associative algebras.- a person who is from 80 to 89 years old.
Magma (algebra)
Free magma
Magma (from Ancient Greek μάγμα (mágma) meaning "thick unguent"[1]) is the molten or semi-molten natural material from which all igneous rocks are formed.[2] Magma is found beneath the surface of the Earth, and evidence of magmatism has also been discovered on other terrestrial planets and some natural satellites.[3] Besides molten rock, magma may also contain suspended crystals and gas bubbles.[4
Z-factor
The Z-factor is a measure of statistical effect size. It has been proposed for use in high-throughput screening (where it is also known as Z-prime,[1] and commonly written as Z' to judge whether the response in a particular assay is large enough to warrant further attention.All models are wrong
PyStan
Hessian matrix
Use in optimization
See also
- The determinant of the Hessian matrix is a covariant; see Invariant of a binary form
- Polarization identity, useful for rapid calculations involving Hessians.
- Jacobian matrix
- Hessian equation
Symmetry of second derivatives
Second derivative
Anderson–Darling test
Eigenvalues and eigenvectors
Confidence interval
Scalar field
Examples in quantum theory and relativity
TensorFlow Probability is a library for probabilistic reasoning and statistical analysis.
Parametric statistics
Monoid
In abstract algebra, a branch of mathematics, a monoid is a set equipped with an associative binary operation and an identity element.
Monoids are semigroups with identity. Such algebraic structures occur in several branches of mathematics.
For example, the functions from a set into itself form a monoid with respect to function composition. More generally, in category theory, the morphisms of an object to itself form a monoid, and, conversely, a monoid may be viewed as a category with a single object.
In computer science and computer programming, the set of strings built from a given set of characters is a free monoid. Transition monoids and syntactic monoids are used in describing finite-state machines. Trace monoids and history monoids provide a foundation for process calculi and concurrent computing.
In theoretical computer science, the study of monoids is fundamental for automata theory (Krohn–Rhodes theory), and formal language theory (star height problem).
Intermarket Relationships: Following the Cycle
Machine learning may help even if you are not a
bicyclic octogenarian semigroup population sampling in Schubert
Calculus just yet
How Bonds Affect the Stock Market
Which Investment Is Better for You?
Variational transition-state theory
Wavelet packet decomposition
Mexican hat wavelet
O'LayDNA-binding domain
Digestion and intestines |
3D Juliaquat: zn+1 = c * (cos(zn)2 - sin(zn)2)^(2) |
http://www.fractal.org/Julius- | |
Variants in the COL6A1, COL6A2, and COL6A3 Genesin Collagen VI-related Congenital Muscular Dystrophy (P2.042)
A topogenic sequence is a collective term used for a peptide sequence present at nascent proteins essential for their insertion and orienting in cellular membranes.
What is the main function of Golgi apparatus?
Duality theory for distributive lattices
The on–off switch of CRISPR immunity against phages in Escherichia coli
Francisco J. M. Mojica, César Díez-VillaseñorA Priestley space is an ordered topological space (X,τ,≤), i.e. a set X equipped with a partial order ≤ and a topology τ, satisfying the following two conditions:
- (X,τ) is compact.
- If ,
then there exists a clopen up-set U of X such that x∈U and y∉ U. (This condition is known as the Priestley separation axiom.)
Genetic algorithm
Chemical laws are those laws of nature relevant to chemistry. The most fundamental concept in chemistry is the law of conservation of mass, which states that there is no detectable change in the quantity of matter during an ordinary chemical reaction. Modern physics shows that it is actually energy that is conserved, and that energy and mass are related; a concept which becomes important in nuclear chemistry. Conservation of energy leads to the important concepts of equilibrium, thermodynamics, and kinetics.
The laws of stoichiometry, that is, the gravimetric proportions by which chemical elements participate in chemical reactions, elaborate on the law of conservation of mass. Joseph Proust's law of definite composition says that pure chemicals are composed of elements in a definite formulation; we now know that the structural arrangement of these elements is also important.
Dalton's law of multiple proportions says that these chemicals will present themselves in proportions that are small whole numbers (i.e. 1:2 O:H in water); although in many systems (notably biomacromolecules and minerals) the ratios tend to require large numbers, and are frequently represented as a fraction. Such compounds are known as non-stoichiometric compounds.
The third stoichiometric law is the law of reciprocal proportions, which provides the basis for establishing equivalent weights for each chemical element. Elemental equivalent weights can then be used to derive atomic weights for each element.
More modern laws of chemistry define the relationship between energy and transformations.
- In equilibrium, molecules exist in mixture defined by the transformations possible on the timescale of the equilibrium, and are in a ratio defined by the intrinsic energy of the molecules—the lower the intrinsic energy, the more abundant the molecule.
- Transforming one structure to another requires the input of energy to cross an energy barrier; this can come from the intrinsic energy of the molecules themselves, or from an external source which will generally accelerate transformations. The higher the energy barrier, the slower the transformation occurs.
- There is a hypothetical intermediate, or transition structure, that corresponds to the structure at the top of the energy barrier. The Hammond-Leffler Postulate states that this structure looks most similar to the product or starting material which has intrinsic energy closest to that of the energy barrier. Stabilizing this hypothetical intermediate through chemical interaction is one way to achieve catalysis.
- All chemical processes are reversible (law of microscopic reversibility) although some processes have such an energy bias, they are essentially irreversible.
Liquid crystal
Writhe
Applications in DNA topology
DNA will coil if you twist it, just like a rubber hose or a rope will, and that is why biomathematicians use the quantity of writhe to describe the amount a piece of DNA is deformed as a result of this torsional stress. In general, this phenomenon of forming coils due to writhe is referred to as DNA supercoiling and is quite commonplace, and in fact in most organisms DNA is negatively supercoiled.[1]
Any elastic rod, not just DNA, relieves torsional stress by coiling, an action which simultaneously untwists and bends the rod. F. Brock Fuller shows mathematically[5] how the “elastic energy due to local twisting of the rod may be reduced if the central curve of the rod forms coils that increase its writhing number”.
See also
CpG islands and python programing mathematical Myocyte models
Island algorithm
M. Heath Farris1,4*, Andrew R. Scott1, Pamela A. Texter1, Marta Bartlett1, Patricia Coleman2and David Masters
Micro-Managing Myocyte Mitosis
and Carole Zoom, here is more interesting research for quantum biology, quantum architecture innovations in Deep Learning:
The dopamine hypothesis of reward. Reinforcement is sometimes called a retroactive effect on learning
because it occurs after the behaviour that is being reinforced (it
affects the still-active memory trace of the behaviour, not the
behaviour itself).
Micro-Managing Myocyte Mitosis
Dopaminergic pathways
Reptation
Glossary of dance moves
What exactly is the 'spin' of subatomic particles such as electrons and protons?Does it have any physical significance, analogous to the spin of a planet?
Nanocar Formula (−1)F
CCR and CAR algebras
Spin
It's more about a particle's identity than its merry-go-round motion.
Zeeman Splitting
Spin (physics)
Electron Spin
Free Action
What fractals, Fibonacci, and the golden ratio have to do with cauliflower
Self-selected mutations during domestication drastically changed shape over time
Conformal symmetry
Rotational invariance
Monte Carlo methods for numerical simulation
Square lattice Ising model
Spin ice
Drude model
You know how models can beStoner model of ferromagnetism
Philosopher's Stone
A rolling stone gathers no moss
Stone algebra
In mathematics, a Stone algebra, or Stone lattice, is a pseudo-complemented distributive lattice such that a* ∨ a** = 1. They were introduced by Grätzer & Schmidt (1957) and named after Marshall Harvey Stone.
Boolean algebras are Stone algebras, and Stone algebras are Ockham algebras.
Examples:
- The open-set lattice of an extremally disconnected space is a Stone algebra.
- The lattice of positive divisors of a given positive integer is a Stone lattice.
In mathematics, a Stone algebra, or Stone lattice, is a pseudo-complemented distributive lattice such that a* ∨ a** = 1. They were introduced by Grätzer & Schmidt (1957) and named after Marshall Harvey Stone.
Boolean algebras are Stone algebras, and Stone algebras are Ockham algebras.
Examples:
- The open-set lattice of an extremally disconnected space is a Stone algebra.
- The lattice of positive divisors of a given positive integer is a Stone lattice.
Stone Algebras - Computer Science and Software
Google’s time crystal discovery is so big, we can’t fully comprehend it
Time translation symmetry
Phase transition
List of chaotic maps
Neural coding
Perceptron
Connectome
Minerals: Their Functions and Sources | ||
Mesenchymal stem cell | ||
Allotransplantation | ||
Conclusions
Overall, our findings suggest that stem cell therapy can potentially provide a new avenue for the treatment of COL6 CMD and other muscular disorders and injuries.
Quantum Biology Spintronic consideration of
The three collagen VI genes and α chains
| α chains | Size (kDa) | Corresponding gene | Gene position |
|---|---|---|---|
| α1(VI) | 140 | COL6A1 | 21q22.3 |
| α2(VI) | 140 | COL6A2 | 21q22.3 |
| α3(VI) | 260–330* | COL6A3 | 2q37 |
Spin chemistry
Radical-pair mechanism
Collagen Type VI-Related Disorders
Anne Katrin Lampe, MD, Kevin M Flanigan, MD, Katharine Mary Bushby, MD, MBCHB FRCP, and Debbie Hicks, PhD.
If no other force is present, the distance between atoms at which the force becomes repulsive rather than attractive as the atoms approach one another is called the Van der Waals contact distance; this phenomenon results from the mutual repulsion between the atoms' electron clouds.[1] The Van der Waals force has the same origin as the Casimir effect, which arises from quantum interactions with the zero-point field.[2]
The Van der Waals forces [3] are usually described as a combination of the London dispersion forces between "instantaneously induced dipoles",[4] Debye forces between permanent dipoles and induced dipoles, and the Keesom force between permanent molecular dipoles whose rotational orientations are dynamically averaged over time.
If no other forces are present, the point at which the force
becomes repulsive rather than attractive as two atoms near one another
is called the van der Waals contact distance.
This results from the electron clouds of two atoms unfavorably coming
into contact. It can be shown that van der Waals forces are of the same
origin as that of the Casimir effect, arising from quantum interactions
with the zero-point field.
Luke 11:11
If a son shall ask bread of any of you that is a father, will he give him a stone?
Sermon... I was thinking about the London Dispersion forces as the
Van der Waals force plays a fundamental role in fields as diverse as supramolecular chemistry, structural biology, polymer science, nanotechnology, surface science, and condensed matter physics. It also underlies many properties of organic compounds and molecular solids, including their solubility in polar and non-polar media.
In mathematics, a Stone algebra, or Stone lattice, is a pseudo-complemented distributive lattice such that a* ∨ a** = 1. They were introduced by Grätzer & Schmidt (1957) and named after Marshall Harvey Stone.
Boolean algebras are Stone algebras, and Stone algebras are Ockham algebras.
Examples:
- The open-set lattice of an extremally disconnected space is a Stone algebra.
- The lattice of positive divisors of a given positive integer is a Stone lattice.
Priestley space
In mathematics, a Priestley space is an ordered topological space with special properties. Priestley spaces are named after Hilary Priestley who introduced and investigated them.[1] Priestley spaces play a fundamental role in the study of distributive lattices. In particular, there is a duality ("Priestley duality"[2]) between the category of Priestley spaces and the category of bounded distributive lattices.[3][4]
Disorder Persists in Larger Graphs, New Math Proof Finds
As pope steps down, disinformation permeates Vatican crackdown on nuns
February 27, 2013 · 11:31 AM UTC
Introduction to the Sermon on the Mount
5 Now when Jesus saw the crowds, he went up on a mountainside and sat down. His disciples came to him, 2 and he began to teach them.
The Beatitudes
He said:
3 “Blessed are the poor in spirit,for theirs is the kingdom of heaven.
A Secret Database of Child Abuse
A former Jehovah's Witness is using stolen documents to expose allegations that the religion has kept hidden for decades.
By Douglas QuenquaRule of law
Brownian motor
William Shatner: Captain's Log
Jewbilee
S-matrix
A Seamless Garment Philosophy, aka, a Consistent Life Ethic as a spirit in the letter may be coupled with the Bridges transition model or the five stages of grief as taught by Kübler-Ross in a police parent poetry competition between municipality and state department in a coordinated effort to serve the Department of Family and Protective Services.
Pope Francis encourages nun helping trans community in Argentina
The home, called The Coast of Limay, has been described as the first permanent residence in the world dedicated to vulnerable transsexual people.
In-group/Out-group
An in-group is a group of people who identify with each other based on a variety of factors including gender, race, religion, or geography. Our tendency to distinguish between in-group and out-group members has moral implications.
TEXAS ETHICS COMMISSION
CHAPTERS 36 & 39, PENAL CODE
Bribery and Corrupt Influence
Abuse of Office
https://www.ethics.state.tx.London dispersion force
London dispersion forces (LDF, also known as dispersion forces, London forces, instantaneous dipole–induced dipole forces, or loosely as van der Waals forces) are a type of force acting between atoms and molecules.[1] They are part of the van der Waals forces. The LDF is named after the German physicist Fritz London.
Contents
Bible jokes, humor and trivia
Like most college professors, I've seen hilarious errors in student-written papers.
Here are two recent ones:
"There were a lot of times where Jesus would speak
to huge crows such as at the Sermon on the Mount."
"What struck me most was they way they embarrassed
the gospel"
Ventral tegmental area
Abstract
Magnesium plays an important role in a large number of cellular
processes by acting as a cofactor in enzymatic reactions and
transmembrane ion movements.
Bringing virtual and augmented reality to the classroom
Piñata Effigy Implicit stereotype Iconoclasm Green Bonds for Artificial neural network Machines learning about Environmental Racism as solutions for Texas Disparity
By David Vincent Bell HirschTraining, validation, and test sets
Gene expression programming
Vector (molecular biology)
In molecular cloning, a vector is a DNA molecule used as a vehicle to artificially carry foreign genetic material into another cell, where it can be replicated and/or expressed (e.g., plasmid, cosmid, Lambda phages). A vector containing foreign DNA is termed recombinant DNA. The four major types of vectors are plasmids, viral vectors, cosmids, and artificial chromosomes. Of these, the most commonly used vectors are plasmids.[1] Common to all engineered vectors have an origin of replication, a multicloning site, and a selectable marker.
The vector itself is generally a DNA sequence that consists of an insert (transgene) and a larger sequence that serves as the "backbone" of the vector. The purpose of a vector which transfers genetic information to another cell is typically to isolate, multiply, or express the insert in the target cell. All vectors may be used for cloning and are therefore cloning vectors, but there are also vectors designed specially for cloning, while others may be designed specifically for other purposes, such as transcription and protein expression. Vectors designed specifically for the expression of the transgene in the target cell are called expression vectors, and generally have a promoter sequence that drives expression of the transgene. Simpler vectors called transcription vectors are only capable of being transcribed but not translated: they can be replicated in a target cell but not expressed, unlike expression vectors. Transcription vectors are used to amplify their insert.
The manipulation of DNA is normally conducted on E. coli vectors, which contain elements necessary for their maintenance in E. coli. However, vectors may also have elements that allow them to be maintained in another organism such as yeast, plant or mammalian cells, and these vectors are called shuttle vectors. Such vectors have bacterial or viral elements which may be transferred to the non-bacterial host organism, however other vectors termed intragenic vectors have also been developed to avoid the transfer of any genetic material from an alien species.[2]
Insertion of a vector into the target cell is usually called transformation for bacterial cells,[3] transfection for eukaryotic cells,[4] although insertion of a viral vector is often called transduction.[5]
Lambda
Sequence Embedding for Clustering and Classification
An embedding is a relatively low-dimensional space into which you can translate high-dimensional vectors. Embeddings make it easier to do machine learning on large inputs like sparse vectors representing words.
(mu) is the size of the parent population; l (lambda) is the size of the offspring
Evolution strategies
Genomic imprinting
Nextstrain: real-time tracking of pathogen evolution
Ghosting (behavior)
Human germline engineering
Ethical and moral debates
Does the Trolley Problem Have a Problem?
What if your answer to an absurd hypothetical question had no bearing on how you behaved in real life?
'the
best physics arguments are very philosophical' - Chiara Maletto
Theoretical physicist Chiara Marletto: ‘The universal constructor could revolutionise civilisation’
Category theory
Higher-dimensional categories
Categorical logic
LK, LJ, Dual Intuitionistic Logic, and Quantum Logic
Embeddings
Allele frequency
Hill–Robertson effect
She wrote some of the most influential papers in contemporary American philosophy and prompted debates about urgent moral concerns in everyday life.
By Alex Traub
South Dakota Moves To Legalize Killing Abortion Providers
A bill under consideration in the Mount Rushmore State would make preventing harm to a fetus a “justifiable homicide” in many cases.
Immanuel Kant
The Family Relationships that Couldn’t Stop World War I
Kant’s Moral Philosophy
Sabr
House of Saud
Inbreeding in the Utah Mormons: an evaluation of estimates based on pedigrees, isonymy, and migration matrices
Why People Kill in the Name of God
The role of self-enhancement in religious aggression
Religious violence
A Brief History of Deadly Attacks on Abortion Providers - The ...
Anti-abortion violence
Religious war
War and religion
Toxicogenomics
Undecidable problem
The crazy math of airline ticket pricing
Traveling Passenger Problems
List of undecidable problems
Halting problem
A key part of the proof is a mathematical definition of a computer and program, which is known as a Turing machine; the halting problem is undecidable over Turing machinesNextstrain is an open-source project to harness the scientific and public health potential of pathogen genome data. We provide a continually-updated view of publicly available data alongside powerful analytic and visualization tools for use by the community. Our goal is to aid epidemiological understanding and improve outbreak response. If you have any questions, or simply want to say hi, please give us a shout at hello@nextstrain.org.
Another Texas GOP lawmaker is attempting to make abortion punishable by the death penalty
Similar bills filed in the Texas Legislature in previous years have failed.
by Shannon Najmabadi March 9, 2021
Trump CDC chief: Coronavirus ‘escaped’ from Chinese lab
The World Health Organization has concluded that theory is “extremely unlikely.”
The Alamo: The First and Last Confederate Monument?
genocide refugees autonomy and sovereignty
By David Vincent Bell HirschDavid’s Law: What is it and who benefits?
“David’s Law?” The law is named this way because of the life it honors and the motivation behind the movement. David Bartlett Molak, age 16, took his own life on Monday, January 4, 2016, in his hometown of San Antonio, Texas. David was a son, brother, Eagle Scout and friend to many. David’s passions included hunting, fishing, professional football and playing various games with his family. In the last few months before his death, David became the repetitive target of relentless cyberbullying. The Molak family describes David’s experience as David becoming “overwhelmed with hopelessness after being continuously harassed, humiliated and threatened by a group of students through text messages and social media.”Mortality Among Teenagers Aged 12-19 Years: United States, 1999-2006
Every day, 22 children and teens (1-17) are shot in the United States. Among those:
- 5 die from gun violence
- 2 are murdered
- 17 children and teens survive gunshot injuries
- 8 are intentionally shot by someone else and survive
- 2 children and teens either die from gun suicide or survive an attempted gun suicide
- 8 children and teens are unintentionally shot in instances of family fire — a shooting involving an improperly stored or misused gun found in the home resulting in injury or death
Every day, 316 people are shot in the United States. Among those:
- 106 people are shot and killed
- 210 survive gunshot injuries
- 95 are intentionally shot by someone else and survive
- 39 are murdered
- 64 die from gun suicide
- 10 survive an attempted gun suicide
- 1 is killed unintentionally
- 90 are shot unintentionally and survive
- 1 is killed by legal intervention*
- 4 are shot by legal intervention and survive
- 1 died but the intent was unknown
- 12 are shot and survive but the intent was unknown
Some 260 shooting deaths were recorded over Fourth of July weekend, according to new data.
Spiritual Warfare (Ephesians 6:10-20)
Why Christians Should Stop Using Luke 22:36 To Condone Gun Ownership for Self Defense Purposes.
What Is the Sword of the Spirit and How Should I Use It?
- Hope Bolinger
Angela Dawne Kennedy
A Quarter Century of U.S. Support for Occupation
National Security Archive provides more than 1,000 documents to East Timor Truth Commission after Bush Administration refuses cooperation
Recently Declassified British Documents Reveal U.K. Support for Indonesian Invasion and Occupation of East Timor. 1975-1976
National Security Archive Electronic Briefing Book No. 174
Edited
by Brad Simpson
Director, Indonesia-East Timor Documentation Project
For
more information contact:
Brad Simpson - 609/751-8206
How George H.W. Bush Rode a Fake National Security Scandal to the Top of the CIA
The killing of a CIA agent in Greece was used to thwart reforms as Bush became the first openly partisan director of the spy agency in 1976.
part 1
Why would everybody be silent?
29 January 2005
Why would the US military ignore 9-11 and other crimes? These excerpts from an interview with Kay Griggs show one reason. Kay Griggs is another woman who wants a better world. Will the men give it to her?
Kay Griggs speaks freely about the unimagined corruption and extent of
the oppressive systems of deception within the leadership nexus of
military intelligence with secret society internationalism.
Kay Griggs, Colonel's Wife, desperate wives, military army sodom marines
Tell-All Interview spies system secret 9/11 norwegians nato ,new york,
,"chesty puller", patton joint blackmail homosexual sin
Kay Griggs: Colonel's Wife Deep State Tell-All 2 of 4
And George Bush CIA 1976
East Timor genocide
For the British Royals, Less Majesty Should Be the Way Forward
There are too many working Windsors. Harry’s now employed elsewhere. Maybe Andrew can get less busy too.
Gov. Greg Abbott says he won't impose lockdowns or mask mandates in Texas as it reports the 2nd-most COVID-19 cases in the US
Energy industry showers Gov. Greg Abbott, other Texas politicians with campaign cash after they passed power grid bills
For some energy experts, the increase in donations for the officials at the close of the session looks like a reward for not passing more stringent regulations and raises questions about whether lawmakers let the oil, gas and the broader energy industry off easy for its massive failures.
by Mitchell Ferman and Carla Astudillo Aug. 4, 2021
Education secretary warns DeSantis, Abbott on masks: 'Don't be the reason why schools are interrupted'
The End of the Era of Accountability?
https://www.educationnext.org/East Timor
Welcome to the Yale East Timor Project, since 2000 a component of the Genocide Studies Program.
Compare and contrast Pandemic
Alberni Indian Residential School
Port Alberni, British Columbia
Trudeau asks Pope Francis to apologise for schools
Infallibility
Pope Rejects Call for Apology to Canada’s Indigenous People
Imperial cult of ancient Rome
Angela Dawne Kennedy
The weapon dance employs weapons—or stylized versions of weapons—traditionally used in combat in order to simulate, recall, or reenact combat or the moves of combat in the form of dance, usually for some ceremonial purpose. Such dancing is quite common to folk ritual in many parts of the world. Weapon dancing is certainly ancient; among the earliest historical references we have are those that refer to the pyrrhichios, a weapon dance in ancient Sparta, in which the dance was used as a kind of ritual training for battle.[1]
There are virtually no parts of the world left where the weapon dance is directly connected with imminent or recent combat. This is especially true of European states, which have long since moved away from the tribalism that usually gives rise to such folk dances. It is, however, also true of parts of the world where tribal traditions have succumbed to colonialism and the forces of globalism. The dances that one sees today are often part of general movements to preserve and rejuvenate tribal or local traditions. Some of these movements are quite strong now, such as those among native North American tribes and the aboriginal peoples of Australia.
Related to weapon dances and war dances is the dance of the hunt. A very early reference to a weapon dance of the hunt comes in the form of a rock carving at Çatal Höyük, the large neolithic settlement in south-central Anatolia.
Overview: James
Know thyself
and beyond cure.
Who can understand it?
Jeremiah was a bull frog Making quantum leaps from Frog Texas to Hell Michigan with mirror neuron maps within
Quantum Clustering Algorithms
.
STAR (gene)
DMRT1
Testis-determining factor
sex-determining region Y (SRY) proteinHairy ball theorem
And the peace of God, which passeth all understanding, shall keep your hearts and minds through Christ Jesus.
Emotional Agility
Shock the Monkey
Clonal interference is a phenomenon in evolutionary biology, related to the population genetics of organisms with significant linkage disequilibrium, especially asexually reproducing organisms. The idea of clonal interference was introduced by American geneticist Hermann Joseph Muller in 1932.[1] It explains why beneficial mutations
can take a long time to get fixated or even disappear in asexually
reproducing populations. As the name suggests, clonal interference
occurs in an asexual lineage ("clone") with a beneficial mutation. This
mutation would be likely to get fixed if it occurred alone, but it may
fail to be fixed, or even be lost, if another beneficial-mutation
lineage arises in the same population; the multiple clones interfere
with each other.
Phra Rahu in Thailand
Rāhu (Sanskrit: राहु)(
Rahu is usually paired with Ketu which is also considered to be a shadow planet. The time of day considered to be under the influence of Rahu is called Rāhu kāla and is considered inauspicious.[2]
As per Hindu astrology, Rahu and Ketu have an orbital cycle of 18 years and are always 180 degrees from each other orbitally (as well as in the birth charts). This coincides with the precessional orbit of the moon or the ~18 year rotational cycle of the lunar ascending and descending nodes on the earth's ecliptic plane. This also corresponds to a saros, a period of approximately 223 synodic months (approximately 6585.3211 days, or 18 years, 11 days, 8 hours), that can be used to predict eclipses of the Sun and Moon. Rahu rules the zodiac sign of Aquarius together with Shani.
Astronomically, Rahu and Ketu denote the points of intersection of the paths of the Sun and the Moon as they move on the celestial sphere. Therefore, Rahu and Ketu are respectively called the north and the south lunar nodes. The fact that eclipses occur when the Sun and the Moon are at one of these points gives rise to the understanding of swallowing of the Sun and the Moon by the snake. Rahu is responsible for causing the Eclipse of the Sun.
Saturn Devouring His Son
Saturn's rippling rings point to massive, soupy core hidden inside
The findings might challenge established models of the formation of gas giants.
Myocyte COL6A1, COL6A2, COL6A3, gene protein directional development, Fibrifold a fibroblast...
Americans with Disabilities Act of 1990
In literary criticism, purple prose is overly ornate prose text that disrupts a narrative flow by drawing undesirable attention to its own extravagant style of writing. This diminishes the appreciation of the prose overall.[1] Purple prose is characterized by the excessive use of adjectives, adverbs, and metaphors. When it is limited to certain passages, they may be termed purple patches or purple passages, standing out from the rest of the work.
Purple prose is criticized for desaturating the meaning in an author's text by overusing melodramatic and fanciful descriptions. As there is no precise rule or absolute definition of what constitutes purple prose, deciding if a text, passage, or complete work has fallen victim is a somewhat subjective decision. According to Paul West, "It takes a certain amount of sass to speak up for prose that's rich, succulent and full of novelty. Purple is immoral, undemocratic and insincere; at best artsy, at worst the exterminating angel of depravity."[2]
City of the Violet Crown
City of the Violet Crown is a term for at least two cities:
- In one of his surviving fragments (fragment 64), the lyric poet Pindar wrote[1] of Athens:
City of light, with thy violet crown, beloved of the poets, thou art the bulwark of Greece.
- The climate of Attica is characterised by low humidity and a high percentage of dust in the air, which make sunsets display hues of violet and purple and the surrounding mountains often appear immersed in a purple haze.
- In Geoffrey Trease's novel The Crown of Violet, the name is explained as referring to the mauve-tinted marble of the Acropolis hill.
- According to the City of Austin's History Center, the phrase first appeared in The Austin Daily Statesman (Now the Austin American Statesman) on May 5th, 1890.[2]
- It was long believed to have originated in O. Henry's story "Tictocq: The Great French Detective, In Austin", published in his collection of short stories The Rolling Stone published October 27, 1894.
- In chapter 2 of Tictocq, O. Henry writes:
The drawing-rooms of one of the most magnificent private residences in Austin are ablaze of lights. Carriages line the streets in front, and from gate to doorway is spread a velvet carpet, on which the delicate feet of the guests may tread. The occasion is the entrée into society of one of the fairest buds in the City of the Violet Crown.
- The phrase is generally thought to refer to the atmospheric phenomenon more commonly known as the Belt of Venus. The phrase is also said to be connected to the moonlight towers of Austin.[3]
- Another explanation: during the 19th century, residents began to call Austin the "Athens of the South" for its university. With his sly reference to the poetry of Pindar, O. Henry may have been satirizing Austin's ambitious claim of a cultural link to ancient Athens.[4]
Savings 101: The Mattress Money
Deuteronomist
"The Princess and the Pea" (Danish: "Prinsessen paa Ærten"; literal translation: "The Princess on the Pea")[1] is a literary fairy tale by Hans Christian Andersen about a young woman whose royal identity is established by a test of her sensitivity. The tale was first published with three others by Andersen in an inexpensive booklet on 8 May 1835 in Copenhagen by C. A. Reitzel.
Andersen had heard the story as a child, and it likely has its source in folk material, possibly originating from Sweden, as it is unknown in the Danish oral tradition.[1] Neither "The Princess and the Pea" nor Andersen's other tales of 1835 were well received by Danish critics, who disliked their casual, chatty style and their lack of morals.[2]
The tale is classified in the Aarne–Thompson–Uther Index as ATU 704, "The Princess and the Pea".
Pound Cake speech
Who has high score with Whac-A-Mole NOW, the Mullah taunted and teased with game face on. What Khazar trader talk the Rabbi jibbed in. Calling dibs on stonemason caber toss tie breaker rites, the Bishop boldly moved on the money talking.
salvo errore et omissione (s.e.e.o.) save for error and omission
scilicet (scire licet)
scientia est potentia
Money from Koch interests flows to governor candidate Greg Abbott
Perhaps Texas AG Ken Paxton is acting as an official government-actor violating statutory and constitutional provisions in favor of business interests of the petroleum energy lobby:
Energy Firms in Secretive Alliance With Attorneys General
In recent news, the "Texas Observer" ran a news story:
"TCEQ: Contested Coal Mine Can Release Wastewater Into Drinking Supply"
And from the 'Houston Chronicle':
"Texas taxpayer tab for suing feds tops $5 million"
"State Officials Investigated Over Their Inquiry Into Exxon Mobil’s Climate Change Research" from the New York Times:
High Levels of Carcinogen Found in Houston Area After Harvey
A Houston company dumped cancer-causing chemicals into a neighborhood storm drain
Harmful chemical found in Houston drinking water
The cancer-causing chemical chromium 6 has been found at high levels in Houston's tap water, according to the nonprofit Environmental Working Group.
by Carol Flake Nov. 29, 2016
Bridges transition model, CWS DFPS, Grassrootsleadership
followup with a song, a grant, bout something dirty in the water:
ACLS Collaborative Research Fellowships
Show me the Mullah: A priestly space in a vacuum Rabi oscillation:
A vacuum Rabi oscillation is a damped oscillation of an initially excited atom coupled to an electromagnetic resonator or cavity in which the atom alternately emits photon(s) into a single-mode electromagnetic cavity and reabsorbs them. Serenity Sells suggests, a microwave photon stored on-chip vacuum Rabi splitting gamma–gamma physics ( photon coupling ) interaction in a magnetic mirror manifold cubic spline. In mathematics, the pin group is a certain subgroup of the Clifford algebra associated to a quadratic space. Priestley spaces play a fundamental role in the study of distributive lattices.The smectic phases of Liquid crystals (LCs) may be manipulated in a torus, a type of a toroid. In mathematics, a toroid is a doughnut-shaped object, a surface of revolution forming a solid body.
Serenity Sells suggests Chiral molecule packing may be computed for solutions with Spin and Pin groups as to derive an anapole magnetic torodial moment superimposed upon Soddy Circles allotropes in Quantum superposition.
In bioinformatics, clique-finding algorithms have been used to infer evolutionary trees, predict protein structures, and find closely interacting clusters of proteins.
Rabi crops or rabi harvest are agricultural crops that are sown in winter and harvested in the spring in India.
In Judaism, a rabbi is a teacher of Torah, for priestly space sake! A random seed (or seed state, or just seed) is a number (or vector) used to initialize a pseudorandom number generator.
Molecular thumb drives: Researchers store digital images in metabolite molecules
iPSCs: A powerful tool for skeletal muscle tissue engineering
This matrix delivers healing stem cells to injured elderly muscles
Muscular dystrophy patients could someday also benefit from this hydrogel successfully tested in mice
- Date:
- August 15, 2018
Towards stem cell therapies for skeletal muscle repair
npj Regenerative Medicine volume 5, Article number: 10 (2020)
Totally disconnected group
Clique
Clique (graph theory)
The Vision of Ezra is an ancient apocryphal text purportedly written by the biblical scribe Ezra. The earliest surviving manuscripts, composed in Latin, date to the 11th century AD, although textual peculiarities strongly suggest that the text was originally written in Greek. Like the Greek Apocalypse of Ezra, the work is clearly Christian, and features several apostles being seen in heaven. However, the text is significantly shorter than the Apocalypse.
The text has a strong dependence on 2 Esdras, an earlier Apocalypse, and portrays God as answering the prayer of Ezra to have courage by sending him seven angels to show him heaven. In the Latin Vision of Esdras, Ezra walks down three floors or 72 steps and is shown hell. When arriving in hell, a soul approaches Esdras and says your coming here has granted us some respite. From there he is taken to the fourth underworld where the sinners are shown hanging by their eyelashes. The righteous he sees in heaven are portrayed as passing through a vast scene of flames and fire-breathing lions, unharmed. The wicked are also seen to be in heaven, but are quickly ripped apart by vicious dogs, and burnt in the fire. Ezra is told by a nearby angel that the crimes of the wicked were that "they denied the Lord, and sinned with women on the Lord’s Day".
Comparable New Testament verses can be found in Luke 16:22: that the beggar died, and was carried by the angels, and in Jesus' reference to the immortal worm in Mark 9:47–48: in hell, the worms that eat them do not die.
Extremally disconnected space
In mathematics, an extremally disconnected space is a topological space in which the closure of every open set is open. (The term "extremally disconnected" is correct, even though the word "extremally" does not appear in most dictionaries.[1] The term extremely disconnected is sometimes used, but it is incorrect.)
An extremally disconnected space that is also compact and Hausdorff is sometimes called a Stonean space. This is different from a Stone space, which is usually a totally disconnected compact Hausdorff space. In the duality between Stone spaces and Boolean algebras, the Stonean spaces correspond to the complete Boolean algebras.
An extremally disconnected first-countable collectionwise Hausdorff space must be discrete. In particular, for metric spaces, the property of being extremally disconnected (the closure of every open set is open) is equivalent to the property of being discrete (every set is open).
In mathematics, a Stone algebra, or Stone lattice, is a pseudo-complemented distributive lattice such that a* ∨ a** = 1. They were introduced by Grätzer & Schmidt (1957) and named after Marshall Harvey Stone.
Boolean algebras are Stone algebras, and Stone algebras are Ockham algebras.
Examples:
- The open-set lattice of an extremally disconnected space is a Stone algebra.
- The lattice of positive divisors of a given positive integer is a Stone lattice.
In mathematics, a Stone algebra, or Stone lattice, is a pseudo-complemented distributive lattice such that a* ∨ a** = 1. They were introduced by Grätzer & Schmidt (1957) and named after Marshall Harvey Stone.
Boolean algebras are Stone algebras, and Stone algebras are Ockham algebras.
Examples:
- The open-set lattice of an extremally disconnected space is a Stone algebra.
- The lattice of positive divisors of a given positive integer is a Stone lattice.
Hund's rule of maximum multiplicity is a rule based on observation of atomic spectra, which is used to predict the ground state of an atom or molecule with one or more open electronic shells. The rule states that for a given electron configuration, the lowest energy term is the one with the greatest value of spin multiplicity.[1] This implies that if two or more orbitals of equal energy are available, electrons will occupy them singly before filling them in pairs. The rule, discovered by Friedrich Hund in 1925, is of important use in atomic chemistry, spectroscopy, and quantum chemistry, and is often abbreviated to Hund's rule, ignoring Hund's other two rules.
Pauli exclusion principle
Spin quantum number
Magnetic quantum number
Alkali metal
All alkali metals have their outermost electron in an s-orbital: this shared electron configuration results in their having very similar characteristic properties.Hall effect
Quantum spin Hall effect
Hall words are in one-to-one correspondence with Hall trees. These are binary trees; taken together, they form the Hall set. This set is a particular totally ordered subset of a free non-associative algebra, that is, a free magma.
Hall algebra
FBI, SSI, Having a Hall Word about Cauchy Machines Hall Marriage theorem
By David Vincent Bell HirschCollective animal behavior
Virtual collective consciousness
Social networking service
Brains Might Sync As People Interact — and That Could Upend Consciousness Research
When we cooperate on certain tasks, our brainwaves might synchronize.
This finding could upend the current understanding of consciousness.
Social exclusion, marginalization or social marginalisation is the social disadvantage and relegation to the fringe of society. It is a term used widely in Europe and was first used in France.[1] It is used across disciplines including education, sociology, psychology, politics and economics.[2]
Collective consciousness
Collective consciousness, collective conscience, or collective conscious (French: conscience collective) is the set of shared beliefs, ideas, and moral attitudes which operate as a unifying force within society.[1] In general, it does not refer to the specifically moral conscience, but to a shared understanding of social norms.[2] The term was introduced by the French sociologist Émile Durkheim in his The Division of Labour in Society in 1893. The French word conscience generally means "conscience", "consciousness", "awareness",[3] or "perception".[4] Commentators and translators of Durkheim disagree on which is most appropriate, or whether the translation should depend on the context. Some prefer to treat the word 'conscience' as an untranslatable foreign word or technical term, without its normal English meaning.[5] As for "collective", Durkheim makes clear that he is not reifying or hypostasizing this concept; for him, it is "collective" simply in the sense that it is common to many individuals;[6] cf. social fact.Collective unconscious
Collective unconscious (German: kollektives Unbewusstes) refers to structures of the unconscious mind which are shared among beings of the same species. It is a term coined by Carl Jung. According to Jung, the human collective unconscious is populated by instincts, as well as by archetypes: universal symbols such as The Great Mother, the Wise Old Man, the Shadow, the Tower, Water, and the Tree of Life.[1] Jung considered the collective unconscious to underpin and surround the unconscious mind, distinguishing it from the personal unconscious of Freudian psychoanalysis. He argued that the collective unconscious had profound influence on the lives of individuals, who lived out its symbols and clothed them in meaning through their experiences. The psychotherapeutic practice of analytical psychology revolves around examining the patient's relationship to the collective unconscious.
Psychiatrist and Jungian analyst Lionel Corbett argues that the contemporary terms "autonomous psyche" or "objective psyche" are more commonly used today in the practice of depth psychology rather than the traditional term of the "collective unconscious."[2] Critics of the collective unconscious concept have called it unscientific and fatalistic, or otherwise very difficult to...
You're Flocking Behavior... It is for the Boids!
Boids
Lee Osheroff Richardson Science Prize
Call for nominations
cognitive science
Animals Count and Use Zero. How Far Does Their Number Sense Go?
Application of the Firefly Algorithm for Solving the Economic Emissions Load Dispatch Problem
Swarm intelligence
Myosin
Myosins (/ˈmaɪəsɪn, -oʊ-/[1][2]) are a superfamily of motor proteins best known for their roles in muscle contraction and in a wide range of other motility processes in eukaryotes. They are ATP-dependent and responsible for actin-based motility. The term was originally used to describe a group of similar ATPases found in the cells of both striated muscle tissue and smooth muscle tissue.[3] Following the discovery by Pollard and Korn (1973) of enzymes with myosin-like function in Acanthamoeba castellanii, a global range of divergent myosin genes have been discovered throughout the realm of eukaryotes.
Although myosin was originally thought to be restricted to muscle cells (hence myo-(s) + -in), there is no single "myosin"; rather it is a very large superfamily of genes whose protein products share the basic properties of actin binding, ATP hydrolysis (ATPase enzyme activity), and force transduction. Virtually all eukaryotic cells contain myosin isoforms. Some isoforms have specialized functions in certain cell types (such as muscle), while other isoforms are ubiquitous. The structure and function of myosin is globally conserved across species, to the extent that rabbit muscle myosin II will bind to actin from an amoeba.[4]
Some examples of biologically important molecular motors:[2]
- Cytoskeletal motors
- Myosins are responsible for muscle contraction, intracellular cargo transport, and producing cellular tension.
- Kinesin moves cargo inside cells away from the nucleus along microtubules, in anterograde transport.
- Dynein produces the axonemal beating of cilia and flagella and also transports cargo along microtubules towards the cell nucleus, in retrograde transport.
- Polymerisation motors
- Rotary motors:
- FoF1-ATP synthase family of proteins convert the chemical energy in ATP to the electrochemical potential energy of a proton gradient across a membrane or the other way around. The catalysis of the chemical reaction and the movement of protons are coupled to each other via the mechanical rotation of parts of the complex. This is involved in ATP synthesis in the mitochondria and chloroplasts as well as in pumping of protons across the vacuolar membrane.[3]
- The bacterial flagellum responsible for the swimming and tumbling of E. coli and other bacteria acts as a rigid propeller that is powered by a rotary motor. This motor is driven by the flow of protons across a membrane, possibly using a similar mechanism to that found in the Fo motor in ATP synthase.
- Nucleic acid motors:
- RNA polymerase transcribes RNA from a DNA template.[5]
- DNA polymerase turns single-stranded DNA into double-stranded DNA.[6]
- Helicases separate double strands of nucleic acids prior to transcription or replication. ATP is used.
- Topoisomerases reduce supercoiling of DNA in the cell. ATP is used.
- RSC and SWI/SNF complexes remodel chromatin in eukaryotic cells. ATP is used.
- SMC proteins responsible for chromosome condensation in eukaryotic cells.[7]
- Viral DNA packaging motors inject viral genomic DNA into capsids as part of their replication cycle, packing it very tightly.[8] Several models have been put forward to explain how the protein generates the force required to drive the DNA into the capsid; for a review, see [1]. An alternative proposal is that, in contrast with all other biological motors, the force is not generated directly by the protein, but by the DNA itself.[9] In this model, ATP hydrolysis is used to drive protein conformational changes that alternatively dehydrate and rehydrate the DNA, cyclically driving it from B-DNA to A-DNA and back again. A-DNA is 23% shorter than B-DNA, and the DNA shrink/expand cycle is coupled to a protein-DNA grip/release cycle to generate the forward motion that propels DNA into the capsid.
- Enzymatic motors:
- Catalase
- Urease
- Aldolase
- Hexokinase
- Phosphoglucose isomerase
- Phosphofructokinase
- Glucose Oxidase
- Synthetic molecular motors have been created by chemists that yield rotation, possibly generating torque.[citation neede
Minimum spanning tree
Protein–ligand complex
A protein–ligand complex is a complex of a protein bound with a ligand[2] that is formed following molecular recognition between proteins that interact with each other or with various other molecules. Formation of a protein-ligand complex is based on molecular recognition between biological macromolecules
and ligands, where ligand means any molecule that binds the protein
with high affinity and specificity. Molecular recognition is not a
process by itself since it is part of a functionally important mechanism
involving the essential elements of life like in self-replication, metabolism, and information processing. For example DNA-replication depends on recognition and binding of DNA double helix by helicase, DNA single strand by DNA-polymerase and DNA segments by ligase. Molecular recognition depends on affinity and specificity.
Specificity means that proteins distinguish the highly specific binding
partner from less specific partners and affinity allows the specific
partner with high affinity to remain bound even if there are high
concentrations of less specific partners with lower affinity.[3]
In organic chemistry, a bent bond, also known as a banana bond, is a type of covalent chemical bond with a geometry somewhat reminiscent of a banana. The term itself is a general representation of electron density or configuration resembling a similar "bent" structure within small ring molecules, such as cyclopropane (C3H6) or as a representation of double or triple bonds within a compound that is an alternative to the sigma and pi bond model.
Protein–ligand complex
A protein–ligand complex is a complex of a protein bound with a ligand[2] that is formed following molecular recognition between proteins that interact with each other or with various other molecules. Formation of a protein-ligand complex is based on molecular recognition between biological macromolecules and ligands, where ligand means any molecule that binds the protein with high affinity and specificity. Molecular recognition is not a process by itself since it is part of a functionally important mechanism involving the essential elements of life like in self-replication, metabolism, and information processing. For example DNA-replication depends on recognition and binding of DNA double helix by helicase, DNA single strand by DNA-polymerase and DNA segments by ligase. Molecular recognition depends on affinity and specificity. Specificity means that proteins distinguish the highly specific binding partner from less specific partners and affinity allows the specific partner with high affinity to remain bound even if there are high concentrations of less specific partners with lower affinity.[3]Tissue Engineering
Tissue engineering (TE) is a rapidly evolving discipline that seeks to repair, replace or regenerate tissues or organs by translating fundamental knowledge in physics, chemistry and biology into practical and effective materials, or devices and clinical strategies.37,38
Variants in the COL6A1, COL6A2, and COL6A3 Genesin Collagen VI-related Congenital Muscular Dystrophy (P2.042)
Brownian motor
Examples in nature
Splicing Life: A Report on the Social and Ethical Issues of GeneticEngineering with Human Beings 1982
Donald S. Fredrickson
"The
possibilities presented by gene therapy and gene surgery may in fact
call into quaestion a central element of democratic political theory and
practice: the commitment to equality of opportunity."
democratic political theory
Equality of opportunity is about treating people fairly and without bias and about creating conditions in the workplace and wider society that encourage and value diversity and promote dignity.
BEA is committed to providing equal opportunity and equal access to ... of the Workforce Innovation and Opportunity Act (WIOA) (29 USC 3248)
https://www.nhworks.org/about-
29 CFR § 38.25 - A grant applicant's obligation to provide a written assurance.
Bio Ethics
Leon R. Kass, M.D., Ph.D
Human germline engineering
Civil liability for damages related to germline and embryo editing against the legal admissibility of gene editing
Dorota Krekora-ZającTexas judge says parents whose kids need an ICU bed will have to 'wait for another child to die'
Can I Appeal Any Case to the Supreme Court of the United States?
Texas Courts of Appeals
A schism (pronounced /ˈsɪzəm/ SIZ-əm, /ˈskɪzəm/ SKIZ-əm or, less commonly, /ˈʃɪzəm/ SHIZ-əm[1]) is a division between people, usually belonging to an organization, movement, or religious denomination. The word is most frequently applied to a split in what had previously been a single religious body, such as the East–West Schism or the Great Western Schism. It is also used of a split within a non-religious organization or movement or, more broadly, of a separation between two or more people, be it brothers, friends, lovers, etc.
A schismatic is a person who creates or incites schism in an organization or who is a member of a splinter group. Schismatic as an adjective means pertaining to a schism or schisms, or to those ideas, policies, etc. that are thought to lead towards or promote schism.
Shepard's Citations
Shepard's Citations is a citator used in United States legal research that provides a list of all the authorities citing a particular case, statute, or other legal authority.[1] The verb Shepardizing (sometimes written lower-case) refers to the process of consulting Shepard's to see if a case has been overturned, reaffirmed, questioned, or cited by later cases.[1] Although the name is trademarked, it is also used informally by legal professionals to describe citators in general[citation needed]—for example, Westlaw's similar electronic citator called KeyCite. Prior to the development of electronic citators like KeyCite during the 1990s, Shepard's was the only legal citation service that attempted to provide comprehensive coverage of U.S. law.[1]
Schism v. United States, 316 F.3d 1259 (Fed. Cir. 2002), was a case decided by the United States Court of Appeals for the Federal Circuit, on appeal from the United States Court of Federal Claims arising out of a 1998 lawsuit brought against the United States in an attempt to ensure that military benefits promised in exchange for military service would continue.[1] Ultimately, the Federal Circuit heard the case en banc and denied the benefits requested by the plaintiffs, leaving it to Congress to fashion a solution.[1] It has been described as "[o]ne of the most important cases the court decided" in the area of military pay and benefits.[2]
Welfare economics
Island (Huxley novel)
Procreative beneficence and the prospective parent
- Julian Savulescu
Utilitarianism
Collective action problem
Queen of Sheba
A notable example in the Old Testament for the topic of communication disorders relates to Moses. ... Exodus 4:10-13—And Moses said unto the Lord, O my Lord, I am not eloquent, neither heretofore, nor since thou has spoken unto thy servant: but I am slow of speech, and of a slow tongue.A Biblical Approach to Treating Stuttering
by Richard Mallard
from Texas, USA
Church of Our Lady Mary of Zion
A conservative Catholic media organization, The Pillar, has published several reports claiming the use of dating apps at several churches and the Vatican.
Fact-checking Lt. Gov. Dan Patrick's false claim that Black Texans are driving COVID surge
Report: Allegations Of Priests Using Grindr Have Unnerved The Catholic Church
The Bible and homosexuality
David and Jonathan, Ruth and Naomi
The account of David and Jonathan in the Books of Samuel has been interpreted by traditional and mainstream writers as a relationship of affectionate regard. It has also been interpreted by some authors as of a sexual nature.[15][16] Theologian Theodore Jennings identifies the story as one of desire for David by both Saul and Jonathan, stating, "Saul's jealousy has driven [David] into Jonathan's arms."[17] Michael Coogan addresses the claim of the alleged homosexual relationship between David and Jonathan and explicitly rejects it.[18]
The story of Ruth and Naomi is also occasionally interpreted by contemporary scholars as the story of a lesbian couple.[19][20] Coogan states that the Hebrew Bible does not even mention lesbianism.[21]
Romani people
Ashkenazi Jews
Ten Lost Tribes
Israeli scholar creates Jewish-Gypsy Forum after discovering biblical link between Jews and Romani people. Since publishing his research findings, he says, he has been contacted by thousands of members of the Romani community, and hundreds have been flocking to Israel for meetings with the forum members.
Gosford Glyphs
' When did Egypt come to Australia?Saint Sarah
Saint Sarah, also known as Sara la Kali ("Sara the Black", Romani: Sara e Kali), is the patron saint of the Romani people. The center of her veneration is Saintes-Pilgrimage[edit]
The day of the pilgrimage honouring Sarah is May 24; her statue is carried down to the sea on this day to re-enact her arrival in France.
Some authors have drawn parallels between the ceremonies of the pilgrimage and the worship of the Hindu goddess Kali (a form of Durga), subsequently identifying the two.[5] Ronald Lee (2001) states:
The name "Sara" itself is seen in the appellation of Durga as Kali in the famed text Durgasaptashati.[7]
Surya Siddhanta
The Sūrya Siddhānta (lit. 'Sun treatise') is a Sanskrit treatise in Indian astronomy in fourteen chapters.[1][2][3] The Surya Siddhanta describes rules to calculate the motions of various planets and the moon relative to various constellations, and calculates the orbits of various astronomical bodies.[4][5] The text is known from a 15th-century CE palm-leaf manuscript, and several newer manuscripts.[6] It was composed or revised c. 800 CE from an earlier text also called the Surya Siddhanta.[3]
According to Indian astrophysicist Jayant Narlikar,
the knowledge of Surya Siddhanta came from Greek astrology. However,
this view is based on an interpolated text found in Anandashrama Pune[7] and
not found in any other version. As per him the field of astrology in
India likely developed in the centuries after the arrival of Greek astrology with Alexan
According to al-Biruni, the 11th-century Persian scholar and polymath, a text named the Surya Siddhanta was written by one Lāta.[6] The second verse of the first chapter of the Surya Siddhanta attributes the words to an emissary of the solar deity of Hindu mythology, Surya, as recounted to an asura (a mythical being) called Maya at the end of Satya Yuga, the first golden age of Hindu mythology, around two million years ago.[6][9]
The text asserts, according to Markanday and Srivatsava, that the earth is of a spherical shape.[2] It treats Sun as stationary globe around which earth and other planets orbit, It calculates the earth's diameter to be 8,000 miles (modern: 7,928 miles),[4] the diameter of the moon as 2,400 miles (actual ~2,160)[4] and the distance between the moon and the earth to be 258,000 miles[4] (now known to vary: 221,500–252,700 miles (356,500–406,700 kilometres).[10] The text is known for some of earliest known discussion of sexagesimal fractions and trigonometric functions.[11][12][13]
The Surya Siddhanta is one of the several astronomy-related Hindu texts. It represents a functional system that made reasonably accurate predictions.[14][15][16] The text was influential on the solar year computations of the luni-solar Hindu calendar.[17] The text was translated into Arabic and was influential in medieval Islamic geography.[18]
Importance in history of science
| Shani (Saturn) | 10,765 days, 18 hours, 33 mins, 13.6 secs | 10,758 days, 17 hours, 48 mins, 14.9 secs | 10,759 days, 5 hours, 16 mins, 32.2 secs |
Kartik (month)
Saturn (Latin: Sāturnus [
Saturn was especially celebrated during the festival of Saturnalia each December, perhaps the most famous of the Roman festivals, a time of feasting, role reversals, free speech, gift-giving and revelry. The Temple of Saturn in the Roman Forum housed the state treasury and archives (aerarium) of the Roman Republic and the early Roman Empire. The planet Saturn and the day of the week Saturday are both named after and were associated with him.
Aion (deity)
Aion (Greek: Αἰών) is a Hellenistic deity associated with time, the orb or circle encompassing the universe, and the zodiac.
The "time" which Aion represented is perpetual, unbounded, ritual, and cyclic: The future is a returning version of the past, later called aevum (see Vedic Sanskrit “Ṛtú ”).
Saturn at opposition August 1-2, near Jupiter
Ripples in Saturn’s Rings Reveal Planet’s Core Is Big and Jiggly
Saturn may have a "fuzzy" core, according to new research.
Saturn’s insides are sloshing around
A new paper suggests Saturn’s core is more like a fluid than a solid, and makes up more of the planet’s interior than we thought.
Contractarianism
Lt. Gov. Dan Patrick draws criticism after making false comments about vaccination among Black population
Contrarian
See also
All the livelong day.
The Eyes of Texas are upon you,
You cannot get away.
Do not think you can escape them
At night or early in the morn --
The Eyes of Texas are upon you
Til Gabriel blows his horn.
| Supreme Court of Texas Pro Bono Program |
The Supreme Court refers cases to the Program when it requests full briefing on the merits and there is at least one party who is proceeding pro se because of his or her financial circumstances. Parties represented by counsel at the petition stage may also request the Appellate Section's Pro Bono Committee to be included in the Program if Court requests merits briefing as well. A full explanation of the proposed Program is available in the attached Proposal that was adopted by the Supreme Court.
|
Shadow (psychology)
"Power tends to corrupt, and absolute power corrupts absolutely. Great men are almost always bad men..." - John Emerich Edward Dalberg-Acton, 1st Baron ActonEnneagram of Personality
Where love rules, there is no will to power; and where power predominates, there love is lacking. The one is the shadow of the other.
- Carl Jung, The Psychology of the Unconscious (1943).
System administrator
Server farm
“Silence is such a coin that one side of which failure has and on the other hand holds the success, adopt it wisely.”
―
Soft skills
Comments
Post a Comment